KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ007220Help
Entry
CpipJ_CPIJ007220  CDS       T01079                                 

Definition
hypothetical protein
Orthology
K14316  
nuclear pore complex protein Nup121
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    CpipJ_CPIJ007220
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 1288 aa AA seqDB search
MNHSSRWTSFGGGGGGDGGSPGLSGNLSRMLSSPMAESTQLERGGNASGRVNLFGSPVRS
VATVTVSGGVKRKPTSPLLNSKTGFKSSGNLSGLGGVASGSRIDAQVYTDAQSRGLVNRL
VRYHDKSQSSLNRSQSMTSLYTKPGQFPVVHLKKTEIKYSPRRNNSITSVRIAPPEKSVF
QANTRSNILRAGSLLIPSAELKPGGGVRQQQSEEEIDAENRVIAPTAEVDAAPTRSVLDA
LKEISRKRINNEELDADRIKKQCKELSEVDSGGGGGGGGVKRARELPSSASPPSRGSADQ
QKKRMCQKNNDILSSLSSSLVMATPKRVEPVQMRPNRLNVDQSFSAMVTPAAFNATIAAT
VESRFEPAKLARMESAPLPQITRPVPDVVQRVIPQPVRPQPTQPRITLFNRKYDESQIRL
EESEPEQDDDEELGGRISFIKPKEKSPIVSSDKLALKRVEKNKLSLLLSCLSDDFDNEEE
VKVTKPPAIPTFTAKDTVDAPPSKPAEQKKPEEPTPTLPKITGISALINNPIKDAGLGKI
DPPTTTQKPPEPAKSSAAGPGFSFGTSTTTTTTSASTPKLADTTFNFPKPTPEVKPAEKP
APAASGGFSFGVDPPPAYSAPKPASTPNLISFSPAPLAKPATTESTGFSFGASTTSTTTS
GQPAVATTTSTQANPIAFGASGFSAFKPPASSAAAAPATTAPPAFGTVTTTSTASSAAPA
GGFSFGAKAVTTSAASATPATNAFSFGGAAKPAAGAAQTPAASVITSSAAPPAFGAAGST
SFAFGTSSSSPAPPAFGAVSNSTVPAFGSTSTSTTPSFGSIATTTTAAPAPTFGGFGNAT
TSSIAPTSAPTTAPPAFGSITTSTTSSTNMFGSASAKPVFGQSSTTNSGAFSFGGNAATT
TPASSAQQPAATQPSANATFSFGGAANAAPTSVFGTGSNNSNQPTFGGNSAGSGTATPSF
GAMAAGAAPPAFGMASSAAKPPAFGASTTTTSAAGGGGVFGTSASVFGGSTTGAATSASS
VFGVQSSTTPAPSPFGGAAAPSSNPSSGGMFGAAAASINNNQSQQSAAPTPFAFGGGATA
QPAAAASTNKPFAFGGGPPNAVAPAAQPVKANSFSFSAAGTTNPVAPVAQSNSAFSFGAS
QQQQQQNNGPPPPAFGSTNSAFSFNSGSSSAATNNSNPNLATVKPFSFGGSAPAAQPAAS
GGIFGGAAAAATSPPPAFNFNQQQQSGVAPAGPFAFNSPVAATPGGPFAMANGGGAPGAG
GPMFSIGTGGGNQQPGRRPIRTATRRLK
NT seq 3867 nt NT seq  +upstreamnt  +downstreamnt
atgaatcactccagccgatggacatcgtttggcggcggcggaggaggagacggcgggagt
cccggcttgagtgggaatctgagccggatgttgagcagtccgatggcggaatcgacgcag
ctggagagggggggcaatgcgagcggtcgggtgaatctgtttggcagcccggtgaggtcc
gtggcgacggttacggtgtccgggggggtcaagcggaagccgacgtcaccgctgctgaac
agcaagacggggtttaagagcagcgggaatctaagcgggttgggaggggtggcgtccgga
agccggattgatgcgcaggtctacacggacgcccagagtcggggtctcgtcaataggctg
gttcgctaccacgacaagtcccaatcgtcgctcaaccggagccaatcgatgaccagtttg
tacacgaaaccgggccaatttccggtggttcatttgaagaagacggaaatcaagtactca
ccccgacggaacaactccatcacgtcggtccggattgccccgccggagaagtccgtgttt
caggcgaacacgcggtccaacatcttgagggccggatcgctgttgattccgagtgcggag
ttgaagccgggtggcggagtcaggcagcagcagtcggaggaggagattgatgccgagaac
cgggtgattgctccgacggcggaggtggacgcggcaccgacgcgcagcgtcctggacgcg
ttgaaggagatttcccgcaagcggatcaacaacgaggagttggacgcggatcggattaag
aagcagtgcaaggagctgagcgaggtggattctgggggagggggaggaggtggcggggtg
aagcgggcccgggagttgccttcgtcggcttcgccgccgtcgcgaggttcggccgaccag
cagaagaagcgcatgtgtcagaagaataacgatattttgagctcgctgagttccagcctg
gtgatggccactccgaagcgggttgagccggtccagatgcggccgaatcggctgaacgtg
gaccagtcgttctcggcgatggttacgcctgcggcgttcaacgctacgatcgcggcgacc
gttgaaagtcgctttgaacctgcgaagttggctcggatggaatcggcaccgttgccgcag
atcacgagacccgttccggacgtggttcaaagggtgattcctcaaccggttagacctcaa
ccgacgcagcctcgaatcacgctgttcaacagaaagtacgacgagtcgcagattcggctg
gaagaatccgagccggagcaggacgacgacgaggaactcggcggccgaatcagcttcatc
aaaccaaaggaaaagtccccgatcgtgagcagcgacaagctcgccctcaaacgcgttgag
aagaacaaactttcccttctgttgagctgtctcagcgatgactttgacaacgaagaggag
gtgaaggtgaccaaacctccggcaattcccacgttcaccgcaaaggacaccgttgacgcg
cccccgtccaaacccgctgaacagaagaaacccgaagaacctacaccaacgctaccgaaa
attaccggaatctccgccctcatcaacaacccaatcaaggacgccggcctcggcaaaatt
gacccaccaacaacgacgcagaaacccccggaaccagcgaaatccagcgcagctggacca
ggcttctccttcggaacttcaacaacgacgacgactacatcggcatcgaccccaaaactt
gcagacaccacgttcaacttcccaaaacctaccccggaggtcaaaccggccgagaaaccc
gcaccggccgcctccggcggcttctccttcggagtagacccacctcccgcgtacagcgcc
cccaaacccgcttcaacgccaaacctgatcagcttctcgccagctccgctggccaaaccc
gcgaccaccgaatcgaccggattttcgttcggagcgtcgactacgtcgacgacgaccagc
ggtcaacctgcggttgccaccacaacttccacgcaagcgaatccgatcgccttcggcgcc
agcgggttcagtgcgttcaaacctccggcaagttcggcggcggcggcgcctgccactacg
gcgccaccggccttcggcacggtgaccacgacttcaactgcaagttccgccgcaccagcg
ggcggattcagcttcggggcgaaggccgtgactacgagcgcggcgtctgcgacgccggct
accaatgctttctcgtttggaggagcggccaaaccggctgctggcgcagctcagacgcct
gcggcgtccgtgattacgtcctcggctgcgccaccggcctttggagcagcaggttcaacc
tcattcgcgttcggaacatcgtcgtcttcgccggctccgcctgcgttcggcgccgtaagc
aactccaccgtaccggccttcggctcaacgagcacctctacgacgccttcgtttggatcc
atagcgacgaccaccacagcggcacctgcacccaccttcggtgggttcggaaacgccacc
acttcatcaatcgcgccaacttctgcgcccacgacggcacctcccgccttcggcagcatc
acaacttcaacgacttcatccacgaacatgtttggaagtgcgagcgctaaacccgtcttc
ggtcaatcctccaccaccaattcaggcgccttctcgtttggcggcaacgccgccaccaca
actcccgcatcctcggcacaacaacccgcggcgacccaacccagcgccaacgccaccttc
agctttggaggtgcggcgaatgccgcacctacgagtgtctttggaaccggctccaacaac
agcaaccaacccaccttcggtggtaattctgcaggaagtggaacggcaacgccgtcgttt
ggtgcgatggccgcaggtgcagctccgccagcttttggtatggcttcttcggcggcaaag
ccgccggcctttggagcgtcaacgacgacgacgtctgccgcgggtggtggtggagtgttt
ggaacgagtgcgtcggtctttggaggttcaacgactggggcggccacgagtgcaagctcc
gtcttcggcgtccaatcctcaaccacgcccgctccgtcaccttttggcggtgcagcagca
ccttcctccaacccatcatccggcgggatgttcggcgcagccgcagcatccatcaacaac
aaccagtcccaacaatccgccgctccaacgccgtttgcctttggtggcggagccaccgca
caacctgccgccgcggcctccaccaacaagccattcgccttcgggggaggacccccgaac
gcggtcgctcccgcagctcaacccgtgaaggcgaacagtttttcgttttcggccgccggg
acgacgaacccggtggcaccggtagctcaatccaactcggcgttcagctttggggcgagt
cagcagcagcagcagcagaataacgggccgccaccgccagcgttcggcagtaccaacagt
gcattctcgttcaactccggcagcagcagcgcggccaccaacaacagcaatccgaacctg
gcgacggtgaagccgttctcgtttggtggaagtgccccggcggcgcaacccgcggcgtcc
ggtggaatttttggcggcgcagccgcggcagcgacctcacccccgccggcgttcaacttc
aaccagcagcagcagtcgggggtggcccctgcggggccgtttgccttcaacagtccggtc
gccgccactccgggaggaccgtttgcgatggccaacggaggtggggcgccgggcgcgggc
ggccccatgtttagcattggaaccggcggtgggaaccagcagcccggccggaggccgatc
cggaccgcaacgcgacgactaaagtag

DBGET integrated database retrieval system