KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ007220Help
Entry
CpipJ_CPIJ007220  CDS       T01079                                 

Definition
hypothetical protein
Orthology
K14316  
nuclear pore complex protein Nup121
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    CpipJ_CPIJ007220
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 1288 aa AA seqDB search
MNHSSRWTSFGGGGGGDGGSPGLSGNLSRMLSSPMAESTQLERGGNASGRVNLFGSPVRS
VATVTVSGGVKRKPTSPLLNSKTGFKSSGNLSGLGGVASGSRIDAQVYTDAQSRGLVNRL
VRYHDKSQSSLNRSQSMTSLYTKPGQFPVVHLKKTEIKYSPRRNNSITSVRIAPPEKSVF
QANTRSNILRAGSLLIPSAELKPGGGVRQQQSEEEIDAENRVIAPTAEVDAAPTRSVLDA
LKEISRKRINNEELDADRIKKQCKELSEVDSGGGGGGGGVKRARELPSSASPPSRGSADQ
QKKRMCQKNNDILSSLSSSLVMATPKRVEPVQMRPNRLNVDQSFSAMVTPAAFNATIAAT
VESRFEPAKLARMESAPLPQITRPVPDVVQRVIPQPVRPQPTQPRITLFNRKYDESQIRL
EESEPEQDDDEELGGRISFIKPKEKSPIVSSDKLALKRVEKNKLSLLLSCLSDDFDNEEE
VKVTKPPAIPTFTAKDTVDAPPSKPAEQKKPEEPTPTLPKITGISALINNPIKDAGLGKI
DPPTTTQKPPEPAKSSAAGPGFSFGTSTTTTTTSASTPKLADTTFNFPKPTPEVKPAEKP
APAASGGFSFGVDPPPAYSAPKPASTPNLISFSPAPLAKPATTESTGFSFGASTTSTTTS
GQPAVATTTSTQANPIAFGASGFSAFKPPASSAAAAPATTAPPAFGTVTTTSTASSAAPA
GGFSFGAKAVTTSAASATPATNAFSFGGAAKPAAGAAQTPAASVITSSAAPPAFGAAGST
SFAFGTSSSSPAPPAFGAVSNSTVPAFGSTSTSTTPSFGSIATTTTAAPAPTFGGFGNAT
TSSIAPTSAPTTAPPAFGSITTSTTSSTNMFGSASAKPVFGQSSTTNSGAFSFGGNAATT
TPASSAQQPAATQPSANATFSFGGAANAAPTSVFGTGSNNSNQPTFGGNSAGSGTATPSF
GAMAAGAAPPAFGMASSAAKPPAFGASTTTTSAAGGGGVFGTSASVFGGSTTGAATSASS
VFGVQSSTTPAPSPFGGAAAPSSNPSSGGMFGAAAASINNNQSQQSAAPTPFAFGGGATA
QPAAAASTNKPFAFGGGPPNAVAPAAQPVKANSFSFSAAGTTNPVAPVAQSNSAFSFGAS
QQQQQQNNGPPPPAFGSTNSAFSFNSGSSSAATNNSNPNLATVKPFSFGGSAPAAQPAAS
GGIFGGAAAAATSPPPAFNFNQQQQSGVAPAGPFAFNSPVAATPGGPFAMANGGGAPGAG
GPMFSIGTGGGNQQPGRRPIRTATRRLK
NT seq 3867 nt NT seq  +upstreamnt  +downstreamnt
atgaatcactccagccgatggacatcgtttggcggcggcggaggaggagacggcgggagt
cccggcttgagtgggaatctgagccggatgttgagcagtccgatggcggaatcgacgcag
ctggagagggggggcaatgcgagcggtcgggtgaatctgtttggcagcccggtgaggtcc
gtggcgacggttacggtgtccgggggggtcaagcggaagccgacgtcaccgctgctgaac
agcaagacggggtttaagagcagcgggaatctaagcgggttgggaggggtggcgtccgga
agccggattgatgcgcaggtctacacggacgcccagagtcggggtctcgtcaataggctg
gttcgctaccacgacaagtcccaatcgtcgctcaaccggagccaatcgatgaccagtttg
tacacgaaaccgggccaatttccggtggttcatttgaagaagacggaaatcaagtactca
ccccgacggaacaactccatcacgtcggtccggattgccccgccggagaagtccgtgttt
caggcgaacacgcggtccaacatcttgagggccggatcgctgttgattccgagtgcggag
ttgaagccgggtggcggagtcaggcagcagcagtcggaggaggagattgatgccgagaac
cgggtgattgctccgacggcggaggtggacgcggcaccgacgcgcagcgtcctggacgcg
ttgaaggagatttcccgcaagcggatcaacaacgaggagttggacgcggatcggattaag
aagcagtgcaaggagctgagcgaggtggattctgggggagggggaggaggtggcggggtg
aagcgggcccgggagttgccttcgtcggcttcgccgccgtcgcgaggttcggccgaccag
cagaagaagcgcatgtgtcagaagaataacgatattttgagctcgctgagttccagcctg
gtgatggccactccgaagcgggttgagccggtccagatgcggccgaatcggctgaacgtg
gaccagtcgttctcggcgatggttacgcctgcggcgttcaacgctacgatcgcggcgacc
gttgaaagtcgctttgaacctgcgaagttggctcggatggaatcggcaccgttgccgcag
atcacgagacccgttccggacgtggttcaaagggtgattcctcaaccggttagacctcaa
ccgacgcagcctcgaatcacgctgttcaacagaaagtacgacgagtcgcagattcggctg
gaagaatccgagccggagcaggacgacgacgaggaactcggcggccgaatcagcttcatc
aaaccaaaggaaaagtccccgatcgtgagcagcgacaagctcgccctcaaacgcgttgag
aagaacaaactttcccttctgttgagctgtctcagcgatgactttgacaacgaagaggag
gtgaaggtgaccaaacctccggcaattcccacgttcaccgcaaaggacaccgttgacgcg
cccccgtccaaacccgctgaacagaagaaacccgaagaacctacaccaacgctaccgaaa
attaccggaatctccgccctcatcaacaacccaatcaaggacgccggcctcggcaaaatt
gacccaccaacaacgacgcagaaacccccggaaccagcgaaatccagcgcagctggacca
ggcttctccttcggaacttcaacaacgacgacgactacatcggcatcgaccccaaaactt
gcagacaccacgttcaacttcccaaaacctaccccggaggtcaaaccggccgagaaaccc
gcaccggccgcctccggcggcttctccttcggagtagacccacctcccgcgtacagcgcc
cccaaacccgcttcaacgccaaacctgatcagcttctcgccagctccgctggccaaaccc
gcgaccaccgaatcgaccggattttcgttcggagcgtcgactacgtcgacgacgaccagc
ggtcaacctgcggttgccaccacaacttccacgcaagcgaatccgatcgccttcggcgcc
agcgggttcagtgcgttcaaacctccggcaagttcggcggcggcggcgcctgccactacg
gcgccaccggccttcggcacggtgaccacgacttcaactgcaagttccgccgcaccagcg
ggcggattcagcttcggggcgaaggccgtgactacgagcgcggcgtctgcgacgccggct
accaatgctttctcgtttggaggagcggccaaaccggctgctggcgcagctcagacgcct
gcggcgtccgtgattacgtcctcggctgcgccaccggcctttggagcagcaggttcaacc
tcattcgcgttcggaacatcgtcgtcttcgccggctccgcctgcgttcggcgccgtaagc
aactccaccgtaccggccttcggctcaacgagcacctctacgacgccttcgtttggatcc
atagcgacgaccaccacagcggcacctgcacccaccttcggtgggttcggaaacgccacc
acttcatcaatcgcgccaacttctgcgcccacgacggcacctcccgccttcggcagcatc
acaacttcaacgacttcatccacgaacatgtttggaagtgcgagcgctaaacccgtcttc
ggtcaatcctccaccaccaattcaggcgccttctcgtttggcggcaacgccgccaccaca
actcccgcatcctcggcacaacaacccgcggcgacccaacccagcgccaacgccaccttc
agctttggaggtgcggcgaatgccgcacctacgagtgtctttggaaccggctccaacaac
agcaaccaacccaccttcggtggtaattctgcaggaagtggaacggcaacgccgtcgttt
ggtgcgatggccgcaggtgcagctccgccagcttttggtatggcttcttcggcggcaaag
ccgccggcctttggagcgtcaacgacgacgacgtctgccgcgggtggtggtggagtgttt
ggaacgagtgcgtcggtctttggaggttcaacgactggggcggccacgagtgcaagctcc
gtcttcggcgtccaatcctcaaccacgcccgctccgtcaccttttggcggtgcagcagca
ccttcctccaacccatcatccggcgggatgttcggcgcagccgcagcatccatcaacaac
aaccagtcccaacaatccgccgctccaacgccgtttgcctttggtggcggagccaccgca
caacctgccgccgcggcctccaccaacaagccattcgccttcgggggaggacccccgaac
gcggtcgctcccgcagctcaacccgtgaaggcgaacagtttttcgttttcggccgccggg
acgacgaacccggtggcaccggtagctcaatccaactcggcgttcagctttggggcgagt
cagcagcagcagcagcagaataacgggccgccaccgccagcgttcggcagtaccaacagt
gcattctcgttcaactccggcagcagcagcgcggccaccaacaacagcaatccgaacctg
gcgacggtgaagccgttctcgtttggtggaagtgccccggcggcgcaacccgcggcgtcc
ggtggaatttttggcggcgcagccgcggcagcgacctcacccccgccggcgttcaacttc
aaccagcagcagcagtcgggggtggcccctgcggggccgtttgccttcaacagtccggtc
gccgccactccgggaggaccgtttgcgatggccaacggaggtggggcgccgggcgcgggc
ggccccatgtttagcattggaaccggcggtgggaaccagcagcccggccggaggccgatc
cggaccgcaacgcgacgactaaagtag

DBGET integrated database retrieval system