KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ007327Help
Entry
CpipJ_CPIJ007327  CDS       T01079                                 

Definition
disulfide-isomerase A6
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    CpipJ_CPIJ007327
Enzymes [BR:cqu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     CpipJ_CPIJ007327
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 436 aa AA seqDB search
MKTWCISALLAVATLAGSGWAMYSPSDNVVELTDGNFERLVVKSDEVWVVEFYAPWCGHC
QQLAPEYKKAASALKGVVKVGGVNCDEQKSVCGQYGVRGFPTIKIFGGNKRSPVDYNGQR
AAKEIAESALAEVKKKVKNILGGGGSGGGSDGGSSDSKDVVELTDANFDKLVLNSEDIWL
VEFYAPWCGHCKNLAPHWAKAASELKGKVKLGALDSTVHTIKAQQFGIQGYPTIKFFPGG
PKDRDTAQDYDGGRTSSDIVNWALEKFSENIPAPEIVQLTSEEVTKKICQEKPLCVISVL
PHILDCDAACRNKFLATLAKMGEKYKKKLWGWLWTEGGAQPEIEATLDIGGFGYPAMAVV
NVKKMKYSLLRGSFSEEGINEFLRDLSYGRGHTAPIKGAELPKIHTIEAWDGKDGQLPEE
EDIDLSDVDLDEKDEL
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgaagacgtggtgcatttcggcactgttggcggtggccaccctggccggttccggctgg
gccatgtactcgccctcggacaacgtggtggagctaacggacggcaactttgagcggttg
gtggtgaagagcgacgaggtgtgggtggtggagttttacgccccgtggtgcggccactgc
cagcaactggcgccggagtacaagaaggcggcctcggcgctgaagggggtggtgaaggtg
gggggagtaaactgtgacgagcagaagagcgtttgcgggcagtacggagtgaggggattc
ccgacgatcaagatcttcggggggaacaagcgctcgccggtggattataatggacagagg
gcggccaaggagatcgcggagtcggcgctggctgaggtgaagaagaaggtcaagaatatt
cttgggggtggtggcagcggtggtggttcggacggaggaagttccgactcgaaagacgtc
gtcgagctgaccgatgccaactttgacaaactggtgctgaacagcgaggatatctggctt
gtggagttctacgcgccgtggtgcggccactgcaagaatctggctccgcactgggcgaag
gccgcttcggagctgaagggcaaggtcaagcttggggcgctggattcgacggttcacacg
attaaggctcaacagtttggaatccagggctatccgacgatcaagttcttcccgggaggt
ccgaaggatcgcgacacggcccaggattacgacggtggtcgcacctcgtcggacattgtc
aactgggcgctggagaagtttagcgaaaacatccccgcgccggagatcgtccagctgact
tcggaagaggtcaccaagaaaatctgccaggagaagccactttgcgtgatctcggttctg
ccgcacatcctcgactgtgacgccgcctgccgaaacaagttcctggctacactcgccaag
atgggtgaaaagtacaagaagaagctgtggggctggctgtggaccgagggcggagctcag
ccggagatcgaggccacgttggacatcggaggcttcggctacccggcgatggccgtcgtc
aacgtgaaaaagatgaagtactcactgctgcgtggatcgttctccgaggaaggcatcaac
gagttcttgcgggatctgtcgtacggccggggtcacaccgcaccgatcaagggcgccgaa
ctgcccaagatccacacgatcgaagcctgggacggcaaggatggccagctgcccgaagag
gaagacatcgatctgtccgacgtcgacttggacgagaaggacgaactgtag

DBGET integrated database retrieval system