KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ007378Help
Entry
CpipJ_CPIJ007378  CDS       T01079                                 

Definition
hypothetical protein
Orthology
K14283  
transforming acidic coiled-coil-containing protein 3
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    CpipJ_CPIJ007378
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 576 aa AA seqDB search
MSEDESKITSEEEEQEDEPEVKTPKGKRGRPAKGAAKTPTPKKAGKKEVDEEQPEQLQQH
AVEEEVGLPTPEVQIVVSDEDCFEQQLQQQDQPEPQQFEFKAPLPVECFQQQSIPLEAGF
PVAQPPDPFQFPQAPQPVEDGEFQPSQNFQFAASDFDFLLSKGNNSPNSGQADEVPRDSL
LLRFDPLLKAPVVARLSTTKEEEPQEELGGFGGGLVELCQPLVQTAPAVEEEHNQQPQQQ
PQQLVYDDHNEQQDVGEGVLLTALEASGFIAVSPTPSNRSSTGSTANIVDAMDEGGEEYK
AQQQPPHCADEEAEDEKMSVDNTMILDYGGGGDGGDGDSGANNITTDRNMSFAETDQDFN
GGGGVGPELDKKSKNESLKIEELERKLAEAEQREEQLLKRITDKDKTISKMSGVVEAYER
AIAELIAEKEQTTQNYEKTCEALKTDSDINAQHLESLEKTFSDLHAKYERMKIITAEYKE
REEELVNERNRFEESLRMQEKRYENMKGHAMTQLETANNKLSELVRNHAQEVTKLKALLK
KEEIYRASVNEQLSQKARENEELVKICEELINGGAN
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaggatgagtccaagatcacttccgaggaggaggagcaggaggacgagcccgag
gtgaagacccccaagggaaagcgcggccgaccggcgaagggagccgccaagacgcccacc
cccaagaaggccggcaagaaagaggttgatgaggaacagccggagcagcttcagcagcac
gcggtggaggaggaggtcggattgcccacaccggaggttcagatcgtcgtcagcgacgag
gattgcttcgagcagcaacttcagcaacaggaccaacctgagccacaacagtttgagttc
aaggcaccgttaccagtggagtgcttccagcagcaatcgattccactggaggcaggcttc
ccagtggcacaacctcctgacccgttccagtttccccaggcaccgcaacccgtcgaagac
ggcgagttccagccttcgcagaacttccaatttgcggcgtccgatttcgatttcctcctg
tcgaaaggcaacaactctcccaactctggccaggcggacgaagtcccgcgagattcactg
ctgctgcggttcgacccgctgctgaaggctccggtcgtggctcgactgagcaccaccaag
gaagaggaaccccaggaagaactcggcggcttcggcggaggcctcgtagaactctgtcaa
ccgctcgtccaaactgctcccgccgtcgaggaagaacacaaccagcagccacaacagcaa
ccgcagcaactcgtctacgacgaccacaacgagcagcaggacgtgggcgaaggcgtactg
ttgacggcgctcgaggccagcgggtttattgccgtctcgccaacgccttccaatcgcagc
tcgacgggctcgactgcgaacatcgtcgacgccatggacgagggcggagaggagtacaaa
gctcagcagcagccgccgcactgcgcagatgaagaagcagaagacgaaaaaatgagcgtt
gacaatacgatgatactggactacggcggtggtggagatggtggtgacggtgacagcggt
gccaacaatattacgacagatcgaaacatgagcttcgccgagacggaccaggatttcaat
ggcggcggcggcgtcggtcccgagctggacaaaaaaagcaaaaacgaatccctcaagatc
gaagagctggagcggaagctggccgaggcggaacagcgcgaggagcagctgctgaagcgg
atcaccgacaaggacaaaaccatctccaagatgagcggcgtcgtcgaggcgtacgagcgg
gccatcgcggaacttatcgccgagaaggagcaaaccacccaaaactacgagaaaacctgc
gaggcgctcaaaaccgacagcgacatcaacgcccagcatctcgaatcgctcgagaaaacc
ttctccgacctgcacgccaagtacgagcgcatgaaaatcatcaccgccgagtacaaggag
cgcgaggaggaactggtcaacgagcggaaccgcttcgaggagagcctccggatgcaggag
aagcgctacgaaaacatgaaaggccacgccatgacccagctcgagacggccaacaacaag
ctgtccgagctcgtccggaaccatgcccaggaggtgaccaagctgaaggccctcctcaag
aaggaggaaatctaccgcgcctcggtcaacgagcagctgagtcagaaggcgcgcgagaac
gaggagctggtcaagatctgcgaggagctcatcaacgggggcgccaactag

DBGET integrated database retrieval system