KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ007462Help
Entry
CpipJ_CPIJ007462  CDS       T01079                                 

Definition
histone acetyltransferase PCAF
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
Notch signaling pathway
Class
Environmental Information Processing; Signal transduction; Notch signaling pathway [PATH:cqu04330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 778 aa AA seqDB search
MNDHSKLVASEVKTEKLDDRAGGDREATRQDSIERILQRKHRVFLLPRNQKLTKLSMYSA
CQGPDCRCTGWKTPEENRHKDVEVDYCPDFQEECRNPNCKHPLEMHISHLGEVNDDQTNE
LLGAIVDVENLYMSMLRETDTDTKKVYAYLFRLLRQCILTRSQAVIRGPLGDPPFEHPSI
SKAVTNFVLHKYSHLSQGELETMTEVAKTFLHCLNHWNFEAPSARKDLNHEDASNYKINY
TRWLVFCHVPAFCSSLRHFETSIVFGRTLLKAVYQYVYQQLLTKCKTEKDRMPPEKRNML
SQLPKFLEALKHEVVNEDSQIWDPNFKPTASLILQKTKRQHEAASSSSAKKSNDPKRYKR
DSDCEDLPDDVVVKALKRINDSNYTSRAEVVFPPNAPRDEAAKAEENRREIEFHVVGNSL
TKPVTKESMLWLLGLHSVFAHQLPGMPREYISQLVFDPKHKTLALIKDGRPIGGICFRTF
ASQGFTEIVFCAVTSSEQVKGYGTHLMNHLKDYSTQRGIKHFLTYADEFAIGYFKKQGFS
KDIKVSRHVYAGYIKEYEGATLMHCELHPSLIYTQFSSVIRKQKEIVKELIAQRQQEVQK
VHPGLSCFKEGLRSIPIESIPGLREVGWRPQYRAQRAARPLEESADPDKLANSLNVVLQS
VRQHSAAWPFLKPVNPTEVPDYYDHIKYPMDLKTMGDRLKNNCANTLERYFQTKMKEIEL
ENESDPEDDDDDDDDEDCVKVTPKAGYGMKTKAISTQSSVVDLIRAEVKPAEGGVGTL
NT seq 2337 nt NT seq  +upstreamnt  +downstreamnt
atgaacgatcattcgaagcttgtggcgtcggaggtgaaaaccgaaaagctggatgaccgc
gctgggggtgatcgggaggccacgcgacaggactcgatcgagcggattctgcagcgtaaa
catcgagtctttctgctgccccggaaccagaagttgaccaaactgtcgatgtattcggcc
tgccagggaccggattgtcggtgcactgggtggaagacccccgaggagaaccggcacaag
gacgtggaggtggactactgtccggactttcaggaagagtgtcgcaacccgaattgcaag
catccgctggagatgcacatttcgcatctgggcgaggtcaacgacgaccagacgaatgag
ctgctcggggccatcgttgacgtggagaatttgtacatgagtatgctgagggagacggac
acggacaccaagaaggtgtacgcgtacctgtttcggctcctgaggcaatgcatcctaacg
agatcgcaagccgtgatccgtggtccgttgggagatcctcccttcgagcatccgtcgatc
tcgaaggctgtcacgaactttgtactgcacaagtacagccacctcagccaaggcgagctg
gaaaccatgaccgaggtggccaaaacgttcctgcactgtttgaaccactggaatttcgag
gccccgagtgcgcgtaaggacttgaaccacgaagatgcttcaaactacaagatcaactac
acgcgctggctcgtattttgtcacgttccggcattttgcagctcgctgcgccactttgaa
acgtcgattgtgtttggtcgcacgctgttgaaggccgtctatcagtacgtctatcaacag
ctgttgaccaaatgcaaaaccgagaaggaccggatgccgccggagaagcgcaacatgctg
tcgcagttgccaaagttcctggaagcgctcaagcacgaagtcgtcaacgaggactcgcaa
atctgggatcccaactttaagccaaccgcctcgttgatactccagaaaaccaaacgccaa
cacgaggcagccagttcttcgagcgcgaaaaaatccaacgatcccaaacgctacaagcgc
gattccgactgcgaagatttaccggatgatgtggttgtaaaggcgctgaagcgaatcaac
gactccaactacacgagccgagccgaggttgtctttcctccgaacgccccgagagacgag
gcggccaaagctgaggagaatcgacgagaaatcgaattccacgtggttggaaattctctt
acaaaacccgttacgaaggaatcgatgctgtggctgctgggtcttcacagcgtgtttgcc
caccagctgcccggaatgccacgggagtacatctcgcagctggtattcgatccaaaacac
aaaacactcgcgctaatcaaggacggccgcccgatcgggggcatctgcttccggacgttc
gcctcgcaaggcttcaccgagattgtgttctgcgcggtaacgagcagcgaacaggtcaag
ggctacggaacccatctgatgaaccatctgaaggattacagcacgcagcgaggcatcaag
catttcctgacgtacgcggacgagtttgccattgggtactttaagaagcagggcttctcg
aaggacattaaggtgtcgcggcacgtgtacgcaggctatatcaaagaatacgagggagcc
actctcatgcactgtgagctacatccgagtttgatttacacgcagtttagttccgttatc
cgaaaacagaaggaaattgtcaaggaattaatcgcgcagcgacagcaagaggtgcagaag
gttcatccggggttgtcctgcttcaaagaagggttgcgtagcattcccatcgagtccatt
ccggggctgcgcgaggtcggctggcggccgcagtaccgagcccaacgcgcggcccgccct
ctcgaagagtccgccgatccggacaagctggccaactcgctgaacgtcgtgctgcagtcg
gtacggcagcactcggccgcgtggcccttcctgaagccggtcaacccgaccgaggtgccc
gattactacgaccacatcaagtatccgatggatttgaaaacgatgggggatcgactcaag
aacaactgcgccaacaccctcgagcggtacttccagacaaagatgaaggaaattgagttg
gagaatgaatctgaccccgaggatgatgacgacgacgacgacgacgaagactgcgtgaag
gtgactccgaaggcaggatacggcatgaaaaccaaggccatttctacgcaaagttctgtc
gtagatttgatcagggccgaggtaaagccggcggagggaggagtaggaacgttgtaa

DBGET integrated database retrieval system