KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ007519Help
Entry
CpipJ_CPIJ007519  CDS       T01079                                 

Definition
serine/threonine-protein kinase 6
Orthology
K11481  
aurora kinase A [EC:2.7.11.1]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Brite
Enzymes [BR:cqu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     CpipJ_CPIJ007519
Protein kinases [BR:cqu01001]
 Serine/threonine protein kinases: Other group
  Aur family [OT]
   CpipJ_CPIJ007519
Protein phosphatases and associated proteins [BR:cqu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CpipJ_CPIJ007519
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 380 aa AA seqDB search
MSHTNKENWKNTQSATVGGGTTSSMAAAAAAAKSAAGVGRFQLKSFQPTGTAESKPQQSL
FKLPPPPRKPEPVATKQPEEPKKDEFKVPTVNQQQQQQPQSGSSSGCGSGKDKKIWTLSN
FDIGRPLGRGKFGNVYLAREKETKFVIALKVLFKKQVHAQGIEHQVRREIEIQSHLRHPN
ILRMYGYFHDETRIYLILEYAPGGTLFSKLQTQPGNKFPEKQCAIYINMLVSALIYLHER
NVIHRDIKPENLLLGHGGDLKIADFGWSVHEPTSTRTTLCGTLDYLSPEMVQGQPHTKNV
DLWSLGVLAYELLVGRAPFHATGFDDTYNKIMKVRYDVPPEMSRPAAHLISRLLVKQPEQ
RMPLEHVAIHPWIKLHADTK
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcacacgaacaaggaaaactggaagaacacacagagcgcgaccgttggcggagga
acgacctcgtcaatggctgccgccgcagcagcggccaagtccgccgccggagttggccga
ttccagcttaaatccttccagcctacgggtacggccgagtccaaaccacagcaatctttg
ttcaagttgcctccgccgccgcgcaaaccggaaccggtggcgacaaaacagccggaagaa
cccaagaaggacgagtttaaagttccaacggttaatcagcagcagcaacagcaaccacaa
tctgggtcgagttcggggtgtgggtccggcaaggataagaaaatctggacgttgagcaat
tttgatattgggcggccgctgggccggggaaagtttggcaatgtgtatttggcccgggag
aaggaaaccaagtttgtgatagcgttgaaggtgctgttcaagaagcaggttcacgctcag
ggtattgaacatcaggttcgtcgagagatcgaaattcagtcacacttgcgccacccgaac
atcctgcgcatgtacgggtacttccacgacgaaacccggatctacctcatcctggagtac
gccccgggagggacgttgttcagcaagttacaaacccagcccggcaacaagttccccgag
aagcagtgtgcaatctacatcaacatgctggtttcggcgctgatctacctgcacgagcgc
aacgtcatccaccgggacatcaagccggagaacctgctgctcggtcacggcggcgacctc
aaaatcgccgactttggctggtcggtccacgagccaacctcgacgcgaacaactctgtgc
ggcacgctcgactacctttcccctgaaatggtccagggtcagccgcacaccaagaacgtg
gacctgtggagtctcggtgtgctcgcgtacgaactgctggtcggacgggcgcccttccac
gcgaccggcttcgacgatacgtacaacaaaatcatgaaggtgcgctacgacgttccgccg
gaaatgtcccgaccggcggcccacctcatctcgcgcctgctcgtcaaacagcccgagcag
cggatgcccctggagcacgtggccatacatccgtggattaagctgcacgccgacaccaag
tga

DBGET integrated database retrieval system