KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ007892Help
Entry
CpipJ_CPIJ007892  CDS       T01079                                 

Definition
acyl-protein thioesterase 1,2
Orthology
K06130  
lysophospholipase II [EC:3.1.1.5]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    CpipJ_CPIJ007892
Enzymes [BR:cqu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     CpipJ_CPIJ007892
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 219 aa AA seqDB search
MAVAPVIIQSAAKHTSTLIFLHGLGDTGHGWATTMGMIRTPDMKVICPTAPTIPVTLNAG
FRMPSWFDLKTLDIGGPEDEEGIKRAAKNVHELIQSEIQAGISANRIMLGGFSQGGALAL
YAALTFAEPLAGVMALSCWLPLHKNFPGILKCPNTVPILQCHGDCDPVVPYKFGQLSSSV
MKSFMKQSQFQSYRGLSHSSNEAELEDMKKFIEKHVPRQ
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atggcagtggctccagtaatcatccagtcggcggccaaacacacctcgacgctcatcttc
ctgcacggattaggagataccggtcatggttgggccaccacgatgggcatgatccggacg
ccggacatgaaggtgatctgcccgacggcgcccaccatcccggtcacactgaacgccggc
ttccgtatgccgtcgtggttcgatttgaaaacactagacattggcggccctgaggacgag
gagggcatcaagcgggccgccaagaacgtccacgagctgatccagagtgagattcaggcc
ggcatttccgccaaccggatcatgctgggagggttctcccagggcggtgccctggccctg
tacgccgcgttgacattcgcggaaccgttggccggcgtgatggcgctgtcctgctggttg
ccactacacaagaacttcccgggcattctcaagtgcccgaacactgtacccattctccag
tgccacggtgattgcgatccggtggtgccgtacaaatttggtcaattatcgtcgagtgtg
atgaagtcgttcatgaagcagtcccagttccagtcgtacagagggctttcgcattcgtcg
aacgaggccgagctggaggacatgaagaaattcatcgaaaagcacgttccccgccagtga

DBGET integrated database retrieval system