KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ007938Help
Entry
CpipJ_CPIJ007938  CDS       T01079                                 

Definition
asparagine synthetase B
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CpipJ_CPIJ007938
Enzymes [BR:cqu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     CpipJ_CPIJ007938
Peptidases [BR:cqu01002]
 Cysteine Peptidases
  Family C44
   CpipJ_CPIJ007938
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 563 aa AA seqDB search
MCGIFSIFLKNPAAAGGSELFRYGGRTESLRELAFRQSSKQRHRGPDYTGLVVDMDAGLV
MVQERLSVLCVKTGSQPFVSEDGTVLLAANGEIYNYRQMAEVVNGVRKAGDGEYVPRSDC
DVIIAYYERFGAEKLMETIRGMFAFVLYDKKTDHVLVARDPIGIIPLYEGTDSEGNVWFA
SEMKCLVEKCSEVKVFPPGHMYYGKRHKLEPKSYYKPQWMFEIPRAQADLEQLRVALEAA
VVSHLQCDVPMGALLSGGLDSSLIASIATKVMRKRHGLDYRLKTYSVGLIGGPDFEYSKM
VSDYIGSDHTEVHFTIDEGLNYIREVIQHVETYDITTVRCSIPLLLLSRFIKSEGIKMIL
SGEGADELFGGYLYFYQAPNPEEFHWETVKRVKNLHFSDCLRANKATAAVGLELRVPFLD
TDFVNHSMSIRPEDRMPQTKVNGTVRSMEKYVLRQAFTNDYLPSEVLWRQKEQFSDGVGY
SWIDTITEYAASHVSDEDFAAASDRYPINPPSTKEAFYYRQIFEELFPHDSCARTVTRWV
PRTDWGCSADPSGRKQTVHLRRK
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaatcttttcgattttcttgaagaacccggccgcagctggaggttcggaactg
ttccggtatggcggtaggacggagtcgctgcgggagctggccttccggcagtcgtccaag
cagagacatcgcgggccggattataccgggctggttgtggatatggatgcgggattggtg
atggttcaggagcggttgtcggtgctgtgcgtcaagaccggcagtcaaccgtttgtgtct
gaagatgggaccgtgctgctggcggccaacggggagatctacaattaccggcagatggct
gaggtggtcaacggtgtgaggaaagctggggatggggagtacgttccgagaagtgattgt
gacgtcatcattgcgtattacgagcggtttggagcggagaagctcatggagacgattcgg
ggaatgtttgcgtttgtgctgtacgacaaaaagactgatcacgtcctggtggcacgggat
ccgatcgggatcattccgttgtacgaggggacggattcggagggaaacgtgtggtttgcc
agcgagatgaagtgcttggtggagaagtgttcagaggtcaaggtgttcccgccagggcac
atgtactacggcaagcggcacaagttggaacccaagtcgtactataaaccgcagtggatg
tttgagatacctcgggcgcaagcggatttggaacagttgagggttgctttggaagccgct
gtggtgtctcatttgcagtgtgacgttccgatgggggcgttgctgagtggaggtctggat
tctagcttgatcgcgtcgatcgctaccaaggttatgcgaaagcgacatggactggactac
cgactgaagacgtacagtgtcggattgattggaggtccggactttgagtacagcaaaatg
gtctccgactacatcggtagcgatcacaccgaggttcacttcacgatcgatgaaggactc
aattacatccgcgaggtgatacagcacgtcgaaacgtacgacataaccacggttcggtgc
tcgatcccgctgctgctgctgtcgaggtttatcaaaagtgaaggcatcaagatgatcttg
tctggcgaaggtgccgacgagctgtttggcggatatctttacttttaccaggctcctaac
ccagaggagttccactgggaaacggtgaagcgtgtcaagaacctgcacttctcggactgc
ttacgtgccaacaaggctacggctgcagttggtctcgaactgcgagtacctttcctcgat
accgacttcgtcaaccactctatgagcattcgcccggaagatcggatgccccagaccaag
gtcaacggaaccgttcgatcaatggaaaagtacgtactccgacaggccttcaccaacgac
tacctcccatcggaagtcctgtggcgacaaaaggagcagttctccgacggcgttggatac
tcgtggatcgataccatcactgagtacgcagcgtcacacgtcagcgatgaagactttgcc
gccgcatccgatcgttaccccatcaacccaccctcgacgaaggaagcgttctactatcgg
cagatcttcgaggagctgttcccgcacgacagctgtgcaaggacggtgacgcgatgggtt
ccccgcacggactggggctgctcggcggatccatccggtcgaaagcagactgtgcacttg
aggagaaagtaa

DBGET integrated database retrieval system