KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ008009Help
Entry
CpipJ_CPIJ008009  CDS       T01079                                 

Definition
josephin-1
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 191 aa AA seqDB search
MGAPVIYHERQVKELCALHALNNLFQDASSFNKTQLDEICRELSPNDFINPHRSILGLGN
YDINVIITALHVKQCEAIWFDKRRDPSCIDTSKIVGLILNVPSKYSIGFMKFPLQRRHWI
SVKKINGEYWNLDSKLDAPQKIGDESQIMEYLRNQLAGNDKELFVVCTQGVESSEAWLLP
EHRRNSTAAEK
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgggcgcccccgtaatctaccacgagcggcaggtcaaggagctgtgcgccctccacgcg
ttgaacaatctgttccaggacgcctccagcttcaacaagacccagctggatgaaatctgt
cgcgagctgtccccgaacgacttcataaacccgcaccggtccatcctgggcctgggaaac
tacgacatcaacgtgataatcaccgcactgcacgtgaaacagtgcgaagccatatggttc
gacaagcggcgggatccgtcctgcatcgacacttccaaaatcgtaggtctaatcctgaac
gtaccctcgaaatactcgatcggattcatgaagttcccgctgcaacggcgccactggatc
agcgtgaagaagatcaacggcgagtactggaacctggactcgaagctggacgcaccgcag
aaaatcggcgacgagtcgcaaatcatggaatacctgcggaaccagctggccggtaacgac
aaggaactgtttgtggtgtgcacgcagggcgtcgagagcagtgaagcgtggctgctgccg
gagcaccggcggaactcgacggcggcggagaagtag

DBGET integrated database retrieval system