KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ008591Help
Entry
CpipJ_CPIJ008591  CDS       T01079                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CpipJ_CPIJ008591
   01230 Biosynthesis of amino acids
    CpipJ_CPIJ008591
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CpipJ_CPIJ008591
   00030 Pentose phosphate pathway
    CpipJ_CPIJ008591
   00051 Fructose and mannose metabolism
    CpipJ_CPIJ008591
   00052 Galactose metabolism
    CpipJ_CPIJ008591
Enzymes [BR:cqu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CpipJ_CPIJ008591
Protein phosphatases and associated proteins [BR:cqu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CpipJ_CPIJ008591
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 793 aa AA seqDB search
MSSAPVQRFIQHGAHKGKGIAVFTSGGDSQGMNAAVRAVVRMGIYVGCKVYFIREGYQGM
VDGGENIIEAGWSSVSSIIHRGGTVIGSARCTDFRERKGRLQAALNLVSRGITNLVVIGG
DGSLTGANLFRQEWSSLLDELLKEGKITQEQRLKYKALHIAGMVGSIDNDFCGTDMTIGT
DSALHRIIEAIDAIVSTAYSHQRTFIMEVMGRHCGYLAIMASLASEADYVFIPEDPVPHN
WPDKLCKKILQVRIKGAERSAGQRLNIIIVSEGAIDREGQPITAEKVKQVVVDKLQQDTR
ITVLGHVQRGGNPSAFDRVLGCRMGAEAVLALMEADDNTEPCVVSLDGNQAVRVPLMECV
QRTKAVAQAMADRNWELAVQLRGRSFARNLETYKMLTRLKPPKSSLDKDGRGVGGYNMAV
MHIGAPACGMNAAVRSFVRNCIYRGDTVMGIHDGIEGLISGNIKKMEWSDVTGWVGQGGA
FLGTKRTLPEGKFKEIAARLKEFKIQALLIIGGFEAYHAAGQLTDQRDNFKEFCIPLVVV
PSTISNNVPGTEFSLGADTGLNEITEICDRIRQSAQGTKRRVFVIETMGGYCGYLATLSG
LAGGADAAYIYEEKFSIKNLQEDVYHMASKMSDGVQRGLILRNEKASDNYNTEFIYRLYS
EEGRGLFSTRMNVLGHMQQGGSPTPFDRNMGTKMAAKCVEWLVEQLKANTQPDGSICAKT
PESACLLGLVRRQYKITSKLKTLFSSRQRIPKQQWWLKLRPLLRILAKHDSTYEEEGLYI
TVDEEMSTDSPVA
NT seq 2382 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcggctccggtgcaacggttcatccaacatggtgcacacaagggcaagggaatt
gccgtgttcaccagcggaggcgattcccagggcatgaacgcggccgtccgcgccgttgtc
cggatgggcatttacgtcggatgtaaggtctacttcatccgcgagggttaccagggcatg
gtggacggcggcgagaacatcatcgaggccggttggtcctcggtgtccagtattatccac
cggggcggtaccgtgatcggttccgctcgttgtaccgatttccgggagcgtaagggtcgt
ctgcaggccgccctcaacctggtcagccgtggcatcaccaacttggtcgtgatcggtggt
gacggttcgctgaccggtgcgaacctgttccggcaggagtggtccagcctgttggacgag
ctgctgaaggagggcaagatcacccaggagcagcgactcaagtacaaggcgctgcacatt
gccggcatggtcggttcgattgataacgatttctgcggtacggacatgaccatcggaacg
gattcggccctgcaccggatcatcgaggccatcgatgccatcgtcagtacggcgtactcg
catcagcgtacgtttatcatggaggtcatgggcagacattgtggttacttggccataatg
gcctctttagctagtgaggcggactatgtgttcattccggaagatcccgtcccgcacaat
tggcccgacaagttgtgtaagaaaatcctccaggtacgcataaagggcgcggaacggtca
gccggtcagcggttgaacatcatcatcgtgtcggagggcgctatcgatcgggagggccaa
cccatcacggccgagaaggtcaagcaggtggtggtggacaagctccagcaggacacccgc
atcacggtgctgggtcacgtgcagcgcggaggcaacccgagtgcgtttgatcgcgtgctg
ggctgccgcatgggtgccgaggccgtgctggccctgatggaggccgacgacaacacggaa
ccgtgcgtcgtctcgctggacggcaaccaggcggtgcgcgtcccgctgatggagtgcgtc
cagcggaccaaggccgtggcccaggcgatggccgaccgcaactgggagctggcggtgcag
ctgcgtggccgctcgttcgcgcgcaacttggagacgtacaagatgttgacccggctgaag
ccgccgaagagctcgctggacaaggacggccgcggcgttggtggttacaatatggccgtg
atgcacatcggagcgccggcttgcggaatgaacgccgccgttcggtcgtttgtgcgtaac
tgcatttaccgcggggacaccgtgatgggcatccacgacggtatcgagggcttgatttcg
ggcaacatcaagaagatggagtggtcggacgtgaccggatgggttggacagggtggtgct
ttcctgggaacgaagcgtacgctgccggagggcaagtttaaggagattgccgctcgtttg
aaggagtttaagattcaagcgctgttgatcatcggagggtttgaggcgtaccatgctgcg
ggtcagctgaccgatcagcgggacaactttaaggagttttgtattccgctggtggttgtt
ccgtcgaccatctcgaacaacgtccccggcacggagttttctctgggtgcggacactggt
ttgaacgagattacggagatttgcgatcgcatccgtcagtcggcccagggaactaaacga
cgcgtgttcgttattgagaccatgggcggctactgtggatatttggccacgttatccggt
ttggccggtggtgccgacgcggcgtacatctacgaggagaagttctccatcaagaatctg
caagaagacgtgtaccacatggcgtccaagatgagcgacggcgtccagcgtgggttgatt
ctgcgcaacgagaaggcctcggacaactacaacaccgagttcatctaccgtctgtactcg
gaggagggccgaggtctgttctcgacccgcatgaacgtgctcggccacatgcagcagggc
ggttcgccgactccgttcgatcgtaacatgggcaccaagatggcggccaagtgcgtcgag
tggctggtcgaacagctgaaggccaacacccagccggacgggtcgatctgcgccaagacg
ccggagagcgcctgcctgctggggctcgtccgccggcagtacaaaatcacgtctaagttg
aaaactcttttttcttccaggcaacgcatccccaagcagcagtggtggctgaagttgcgc
ccgctgctcagaattctggccaagcacgactcgacctacgaggaggaaggtctttacatc
accgttgacgaggagatgtccacggattcgcccgtcgcttaa

DBGET integrated database retrieval system