KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ008625Help
Entry
CpipJ_CPIJ008625  CDS       T01079                                 

Definition
dfg10 protein
Orthology
K12345  
3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Brite
Enzymes [BR:cqu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     CpipJ_CPIJ008625
    1.3.1.94  polyprenol reductase
     CpipJ_CPIJ008625
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 315 aa AA seqDB search
MLDTLLDLRSINLINFLFVQLFVLIVVLGGLIATVERYLPNAIRQSFRYGKHAFQGPQDR
FTSLLEVPKSWFKHFYVFAAVWSVAGFYFMVNAYFLGRPTPGFVVDFLDIMATSKRTVRT
TPTETMVAITLITIQCLRRWYETQFVQVFSSKLKMNLSAYLVGYVHYFGEVVALLSQADG
FVRENTAASLMPYRFELTPRIAFWIAIFIYAWRYQFQSNLILANLRKDRTGAVTTQKHSI
PRGGYFELVSSPHMFFEVVMYVALYGLTWRNTSSLYVLGWVISNQMMNAWLTHQWYRENF
KEYPSTRRALIPYLL
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgctggacacgctgttggatctgcgttcgatcaacctgatcaactttctcttcgtgcaa
ctgtttgtcctgattgtggttttgggtggtttaattgccacggtagagcgatacctgccg
aacgccatcaggcagtcgtttcggtatggcaaacacgccttccagggtccccaggaccgc
tttacgtccctgctggaggttcccaagtcgtggttcaagcacttttacgtgtttgccgcg
gtctggtctgtggctgggttctactttatggtgaatgcctacttcttgggtcgcccgacg
cccgggtttgtggtggactttttggacattatggccaccagcaagcgaacggttagaaca
acccctacggagaccatggtggccatcacgctgataaccatccagtgccttcgtcggtgg
tacgaaacgcagtttgtgcaggtgttttccagcaagctgaaaatgaacctgtccgcttac
ctcgtgggttacgtgcactattttggtgaagttgttgcgctcctatcgcaagctgatgga
ttcgtccgggagaacactgccgcttcgttgatgccgtaccgcttcgagctgaccccgcgg
atcgctttctggattgcgatcttcatctacgcgtggcgctatcagtttcagtcgaacctg
atcctcgccaacctgcgcaaggatcgcaccggtgccgtcacgacccaaaagcattccatt
ccccggggaggatactttgagctcgtctcgtcgccgcacatgttcttcgaggtcgtgatg
tacgtcgcactttacggactcacctggcgcaacacgtccagtctgtacgtgctcggctgg
gtgatttctaatcagatgatgaacgcctggctcacccaccagtggtatcgggagaacttt
aaggagtacccttcgacgcggcgcgccttgattccttacctgctgtga

DBGET integrated database retrieval system