KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ008683Help
Entry
CpipJ_CPIJ008683  CDS       T01079                                 

Definition
L-asparaginase
Orthology
K13278  
60kDa lysophospholipase [EC:3.1.1.5 3.1.1.47 3.5.1.1]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Brite
Enzymes [BR:cqu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     CpipJ_CPIJ008683
    3.1.1.47  1-alkyl-2-acetylglycerophosphocholine esterase
     CpipJ_CPIJ008683
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.1  asparaginase
     CpipJ_CPIJ008683
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 699 aa AA seqDB search
MTTPNPPTVVSTTAASSPSDDEEGGLVMHLINSRTTNGSSSSKVSSTTSNGNGSPWPRRQ
LVDVNPRSGSLDLSKLPMRRNSSYGRMPSENPEAKVLVIYTGGTIGMMRNEKNALEPRPN
EFVRKIRQYPNMHDDAYAAKRYGPAKNMAPLVLPYVEGQHRRILYQISEYEPLLDSSNMG
VSDWARIATDIQQSYEFFDGFVVLHGTDTLSYTASALSFMLENLGKTVIITGSQIPIFET
RTDGKDNFTSALILAGNYIIPEVCVFFNSRLFRGNRTLKISCDSLDAFNSPNAAPLAKMG
INVEVDYRLIFRPCTVEKFSVHTQMDENVGLLRLFPSIAVATVKAFLQPPMRGVVLQTYG
SGNIPTNRADLLAALREANERGVLIVNCTQCNEGAVCELYETGRQLQELGVIPGFDMTPE
SALAKLSYVLSKDCWNQETKRLMLKSNLRGELTHEKTPEMQEYDLIDAVARTLHLNSVKE
LSQLKSTLFPAMMNAAVVAGDVSKLNNLKGYGANVSGENCDRRTALHVACCEGNLEVVQY
LLQNGAAVHLRDRYDRTPLADAILNDHHQIIRLLIKCGAHLTGSIRAIGESLCSAAARNL
PHRLESYRIAGADLSQEDPAGRTALHVAAMYGNLEVVQYLVKNYAEVDALDYLGLTPLDY
AIKLNAQPVIDFLSGKNARRGEEMSDEARRPELHDSFDY
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccccgaaccccccaaccgtggtcagcacgaccgccgcgtcgagtccctcggac
gacgaggagggtggcctcgtgatgcacctcatcaactcccgcaccaccaacggatcgtca
tcgtccaaggtgtcctcgacgacgagcaacggcaacggttccccgtggccccggcggcag
ctagtggacgtgaaccctcggagtggcagtttggacctgagcaagctgccgatgcgccgg
aactcgagctacggccggatgccgtcggagaacccggaggcgaaagtgctggtcatctac
acgggcggaacgatcgggatgatgcgcaacgagaagaatgcgctggaaccacggccgaac
gagtttgtgcggaagattcgtcaatatccaaacatgcacgatgacgcgtatgcggcgaag
aggtatggaccggcgaagaatatggctccgttggtgcttccttacgtggagggtcaacat
aggaggatcttgtaccagatttccgagtatgaaccgttgctggactcttccaacatggga
gtgtcggactgggcgaggatcgccacggatattcagcagtcgtacgaattcttcgatggg
tttgtcgtactccacggaaccgatacgctgtcctacacggcgtctgctttgtcgttcatg
ctggagaacctcggcaaaacggtgatcatcacggggtcgcagattccgatcttcgagacg
agaaccgacggcaaggacaatttcacctccgcgttgattctggccggaaactacatcatt
ccggaggtttgtgtcttcttcaacagtcgtctcttccgaggcaatcgaacgcttaagatc
agctgcgattcgttggacgcgttcaactccccaaacgcggcacccctagccaagatgggc
atcaacgtggaggtcgactaccggttgatcttccgaccgtgtaccgttgaaaagttcagc
gtgcacactcagatggacgagaacgtcggactgctgcggctgtttccaagtatcgccgtt
gcaacggtaaaggccttcctgcaacctccaatgcgcggggttgtcctgcagacctacggt
tccggaaacatcccaacgaaccgagccgacctgctggcagctctacgcgaagccaacgaa
cgtggagtcctgatcgtcaactgtacccagtgcaacgagggagccgtctgcgagctctac
gaaacgggtcgccagctgcaagagctcggagtcattcccggattcgacatgaccccggaa
tcggcactggcgaagctctcctacgtgctgagtaaggactgctggaaccaagagacgaag
cgattgatgctcaaaagcaacctccgcggcgagctgacccacgaaaagaccccggaaatg
caagagtacgacctgatcgacgccgtcgcccgcactctccacctcaactcggtcaaagaa
ctcagccagctcaagtccaccctcttcccggcgatgatgaacgcggccgtagtcgccggc
gacgtctccaagctcaacaacctcaaagggtacggtgcaaacgtctccggagagaactgc
gaccgccgaaccgctctccacgtggcctgctgcgaaggtaacctcgaagtcgtccaatac
ctgctccaaaacggagcggccgtccacctgcgcgatcgctacgaccgaaccccactcgcg
gacgcgatcctcaacgatcatcaccagatcattcgcctgctaatcaaatgtggtgcccac
ctgaccgggtcgatccgggccatcggggaaagtttgtgcagtgccgcggcgcggaatctg
ccgcatcggctagagtcgtaccggattgccggggccgatctgtcgcaggaggatccggcg
gggcggacggcgctgcacgtggcggcgatgtacggaaatctcgaggtcgttcagtatctg
gtgaagaattacgccgaagtggacgcactggactatttgggactgacgccgttggactac
gcgatcaagctgaacgcacaaccggtgattgactttttgagcgggaagaatgcacgaagg
ggcgaggagatgtccgatgaggccagaaggccggaactgcacgattcgtttgattattag

DBGET integrated database retrieval system