KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ008768Help
Entry
CpipJ_CPIJ008768  CDS       T01079                                 

Definition
chitooligosaccharidolytic beta-N-acetylglucosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:cqu00520]
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan degradation [PATH:cqu00531]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series [PATH:cqu00603]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - ganglio series [PATH:cqu00604]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:cqu00511]
Cellular Processes; Transport and catabolism; Lysosome [PATH:cqu04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 622 aa AA seqDB search
MSPPEKTWTYRCVNNRCVRQHYIEQGDSESSYGGSTPGKRVPFLTCTMTCGPINIWPQPT
AKATIGSKTSRFRLADLNVHIKAAAQPVEGLLRDAFGVFKEELRATLAAHGAAGEDGEAV
AAASLVTESGKEPGKEPSADGKIHFYKPVDENRYDVDKFDVRITVLKSPDVYLTMQTDES
YNLSVTHTARSLVAKVFANSFFGAKHALTTMQQLVWFDDEERVLKILNKALIEDVPRFNF
RGLMLDTSRHYFSVDAIKRTLVGMSHSKLNRFHWHITDSQSFPYVSKHYPQLARYGAYSD
REIYTTDDVREVVEYARVRGIQVIPEIDAPAHAGNGWDWGPKHNLGELSLCINQQPWSYY
CGEPPCGQLNPKNNNTYLILQRLYEELLELAGPLDYFHLGGDEVNLECWQQHFNESDMRT
LWCDFMQQAYHRLQVANKGVAPKLAAVWSSGLTSYPCLSKNTYAVQVWGGSKWQENYQLI
NAGFSLVISHVDAWYLDCGFGSWRSTGEGACSPYRNWQTVYKHRPWDEMKLTSLQMRQIL
GGEACLWTEQVDESTLDSRLWPRSAALAERLWTDPVEEVYSESVPKETFNRMSVFRNHLV
ELGLRAEPIFPKYCAQNQDECV
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgagtccaccggagaaaacgtggacgtaccggtgcgtcaacaatcgctgcgtccggcag
cactacatcgagcagggcgattcggagagctcgtacggtggcagtaccccgggcaagcgg
gtacccttcctgacgtgcaccatgacctgtggcccgataaacatctggccccagcccacg
gccaaggccaccatcggcagcaagacgtcccgcttccggctggcggacctcaacgtgcac
atcaaagcggcggcccagcccgtcgagggtctgctgcgggacgccttcggagtgttcaag
gaggaactgcgcgccaccttggcggcgcacggagccgcgggggaagacggagaagcggtg
gcggcggcttcgttggtgaccgagagcgggaaggaaccgggcaaggagccttccgcggac
ggtaagattcacttttacaaaccggtggacgagaaccggtacgacgtggacaagtttgac
gttcggattacggtgctcaagtcgccggacgtgtacctgacgatgcagacggacgagagc
tacaacctgtcggtgacgcacacggcccgcagcctggtggccaaggtgttcgccaacagc
ttctttggggcgaagcacgccctcacgacgatgcagcagctggtgtggtttgacgacgag
gagcgcgtcctgaagatactgaacaaagccttaatcgaagatgtgccaagatttaacttc
cgcggccttatgctggacacctcgcggcactacttctcggtggacgcgatcaagcgcacc
ctggtggggatgtcccactcgaagctgaaccggttccactggcacataacggactcgcag
agcttcccgtacgtgtcgaagcactatccgcagttggcacgctacggggcgtactcggac
cgggagatttacacgacggacgatgtgagggaggtggtggagtacgcgcgggtacggggc
attcaggtgattccggagattgacgcaccggcacacgccggcaacgggtgggactgggga
ccgaagcacaatctgggcgagttgagcttgtgcattaatcagcaaccgtggagttattat
tgtggggagccgccgtgcggacagttgaacccgaagaacaacaacacgtacttgatcctg
cagcggttgtacgaggagttgctggagcttgcggggccgctggattatttccacctgggt
ggggacgaggtcaacctggagtgttggcagcagcactttaacgagtcggacatgcgaacg
ctgtggtgtgactttatgcagcaggcttatcacaggttacaggttgcgaacaagggggtg
gcaccgaagctggcggccgtctggtccagcgggctgaccagctatccgtgtctgtcaaag
aacacctacgcggtgcaggtttggggcggttccaagtggcaggagaactaccagctgatc
aacgccggattcagtttagtgatatctcacgtggacgcgtggtacctggactgtggattt
ggcagctggcggtcaacgggtgaaggcgcctgctcgccgtatcgcaactggcaaacggtg
tacaaacaccggccctgggacgagatgaagctgacctcgctgcagatgcgccaaatcctc
ggcggcgaggcgtgcctctggacggaacaggtggacgaatcgacgctggactcgcggctg
tggccccggtcagcggccctcgccgaacgcctctggaccgacccggtcgaggaagtgtac
agcgaatccgtgccgaaggaaacgttcaaccggatgtcggtcttccggaaccacctggtc
gagctgggcctgcgggcggaaccgatcttccccaagtactgcgcccagaaccaggacgag
tgtgtatga

DBGET integrated database retrieval system