KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ008768Help
Entry
CpipJ_CPIJ008768  CDS       T01079                                 

Definition
(RefSeq) chitooligosaccharidolytic beta-N-acetylglucosaminidase
  KO
K20730  
beta-hexosaminidase Fdl [EC:3.2.1.52]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    CpipJ_CPIJ008768
Enzymes [BR:cqu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     CpipJ_CPIJ008768
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
VectorBase: 
UniProt: 
AA seq 622 aa AA seqDB search
MSPPEKTWTYRCVNNRCVRQHYIEQGDSESSYGGSTPGKRVPFLTCTMTCGPINIWPQPT
AKATIGSKTSRFRLADLNVHIKAAAQPVEGLLRDAFGVFKEELRATLAAHGAAGEDGEAV
AAASLVTESGKEPGKEPSADGKIHFYKPVDENRYDVDKFDVRITVLKSPDVYLTMQTDES
YNLSVTHTARSLVAKVFANSFFGAKHALTTMQQLVWFDDEERVLKILNKALIEDVPRFNF
RGLMLDTSRHYFSVDAIKRTLVGMSHSKLNRFHWHITDSQSFPYVSKHYPQLARYGAYSD
REIYTTDDVREVVEYARVRGIQVIPEIDAPAHAGNGWDWGPKHNLGELSLCINQQPWSYY
CGEPPCGQLNPKNNNTYLILQRLYEELLELAGPLDYFHLGGDEVNLECWQQHFNESDMRT
LWCDFMQQAYHRLQVANKGVAPKLAAVWSSGLTSYPCLSKNTYAVQVWGGSKWQENYQLI
NAGFSLVISHVDAWYLDCGFGSWRSTGEGACSPYRNWQTVYKHRPWDEMKLTSLQMRQIL
GGEACLWTEQVDESTLDSRLWPRSAALAERLWTDPVEEVYSESVPKETFNRMSVFRNHLV
ELGLRAEPIFPKYCAQNQDECV
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgagtccaccggagaaaacgtggacgtaccggtgcgtcaacaatcgctgcgtccggcag
cactacatcgagcagggcgattcggagagctcgtacggtggcagtaccccgggcaagcgg
gtacccttcctgacgtgcaccatgacctgtggcccgataaacatctggccccagcccacg
gccaaggccaccatcggcagcaagacgtcccgcttccggctggcggacctcaacgtgcac
atcaaagcggcggcccagcccgtcgagggtctgctgcgggacgccttcggagtgttcaag
gaggaactgcgcgccaccttggcggcgcacggagccgcgggggaagacggagaagcggtg
gcggcggcttcgttggtgaccgagagcgggaaggaaccgggcaaggagccttccgcggac
ggtaagattcacttttacaaaccggtggacgagaaccggtacgacgtggacaagtttgac
gttcggattacggtgctcaagtcgccggacgtgtacctgacgatgcagacggacgagagc
tacaacctgtcggtgacgcacacggcccgcagcctggtggccaaggtgttcgccaacagc
ttctttggggcgaagcacgccctcacgacgatgcagcagctggtgtggtttgacgacgag
gagcgcgtcctgaagatactgaacaaagccttaatcgaagatgtgccaagatttaacttc
cgcggccttatgctggacacctcgcggcactacttctcggtggacgcgatcaagcgcacc
ctggtggggatgtcccactcgaagctgaaccggttccactggcacataacggactcgcag
agcttcccgtacgtgtcgaagcactatccgcagttggcacgctacggggcgtactcggac
cgggagatttacacgacggacgatgtgagggaggtggtggagtacgcgcgggtacggggc
attcaggtgattccggagattgacgcaccggcacacgccggcaacgggtgggactgggga
ccgaagcacaatctgggcgagttgagcttgtgcattaatcagcaaccgtggagttattat
tgtggggagccgccgtgcggacagttgaacccgaagaacaacaacacgtacttgatcctg
cagcggttgtacgaggagttgctggagcttgcggggccgctggattatttccacctgggt
ggggacgaggtcaacctggagtgttggcagcagcactttaacgagtcggacatgcgaacg
ctgtggtgtgactttatgcagcaggcttatcacaggttacaggttgcgaacaagggggtg
gcaccgaagctggcggccgtctggtccagcgggctgaccagctatccgtgtctgtcaaag
aacacctacgcggtgcaggtttggggcggttccaagtggcaggagaactaccagctgatc
aacgccggattcagtttagtgatatctcacgtggacgcgtggtacctggactgtggattt
ggcagctggcggtcaacgggtgaaggcgcctgctcgccgtatcgcaactggcaaacggtg
tacaaacaccggccctgggacgagatgaagctgacctcgctgcagatgcgccaaatcctc
ggcggcgaggcgtgcctctggacggaacaggtggacgaatcgacgctggactcgcggctg
tggccccggtcagcggccctcgccgaacgcctctggaccgacccggtcgaggaagtgtac
agcgaatccgtgccgaaggaaacgttcaaccggatgtcggtcttccggaaccacctggtc
gagctgggcctgcgggcggaaccgatcttccccaagtactgcgcccagaaccaggacgag
tgtgtatga

DBGET integrated database retrieval system