KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ008998Help
Entry
CpipJ_CPIJ008998  CDS       T01079                                 

Definition
clk2
Orthology
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Brite
Enzymes [BR:cqu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     CpipJ_CPIJ008998
Protein kinases [BR:cqu01001]
 Serine/threonine protein kinases: CMGC group
  CLK family
   CpipJ_CPIJ008998
Spliceosome [BR:cqu03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    CpipJ_CPIJ008998
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 359 aa AA seqDB search
MTLLLLGMNWRADKILATLGEGTFGRVVKVKDMEMDHTMALKVIKNVEKYREAAKLEINA
LEKIAEKDPTFQHLCVKMLDWFDYHGHMCIAFEMLGLSVFDFLRENNYEPYPMDHVRHMA
YQLCYAVKFLHDNKLTHTDLKPENILFVDSEFTTSFNNRKNREVRRVKCTDIRLIDFGSA
TFDHEHHSTIVSTRHYRAPEVILELGWSQPCDVWSIGCIMFELYLGITLFQTHDNREHLA
MMERILGTIPYRMARKTRTKYFHHGKLDWDEKSSAGRYVRDHCKPLHRYVLAETPDHLQL
FDIIRRMLEYDPANRITLSEALRHPFFAKLPAAQRLHDKCNENSVSGSSSRERSHSLSR
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgacgttgctgctccttggaatgaattggcgagcagataaaatcctggccaccctaggc
gagggtaccttcggcagggtggtgaaagtcaaggatatggagatggatcacacgatggcg
ctcaaggtgatcaagaacgtggaaaagtatcgggaagcggccaagctggaaatcaacgca
ctggagaagatcgccgaaaaggacccaacgttccaacatttatgcgtcaaaatgctggat
tggtttgactaccacggccacatgtgcatcgcgttcgaaatgctcgggctgagtgttttc
gactttctaagagaaaacaactacgaaccgtacccgatggaccacgtgcggcacatggcc
taccagctgtgctacgcggtcaagttcctgcacgacaacaagctcacccacaccgacctc
aagccggagaacatcctgtttgtggactcggagtttaccacgtcgttcaacaaccggaag
aaccgcgaagtgcgtcgcgtcaagtgcaccgacatccgcctgattgattttggcagcgcc
acgttcgaccacgagcatcacagcacgatcgtgtccacccgtcactaccgagcgccggaa
gtaatcctggaactgggctggtcgcaaccgtgcgacgtctggtcgataggttgtataatg
tttgagctgtatctaggcattacgctattccaaacccacgacaaccgagaacacctcgca
atgatggagcgtatactgggtacaattccgtaccgaatggccagaaaaacccgcaccaaa
tacttccaccacggcaagctcgactgggacgagaagtcgagcgcgggccggtacgtgcgc
gaccactgcaagccgctgcaccggtacgtgctggcggagacgcccgaccacctgcagctg
ttcgacatcatccggcgcatgctggagtacgatcccgccaacagaatcacgctgagtgaa
gccctccggcatccgttcttcgcgaagcttcccgcggcgcagcgcctgcacgataagtgt
aatgaaaattccgtctcgggcagtagtagccgggagcggtcccacagtttatcgagatga

DBGET integrated database retrieval system