KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ009002Help
Entry
CpipJ_CPIJ009002  CDS       T01079                                 

Definition
purine biosynthesis protein 6, pur6
Orthology
K01587  
phosphoribosylaminoimidazole carboxylase / phosphoribosylaminoimidazole-succinocarboxamide synthase [EC:4.1.1.21 6.3.2.6]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
Purine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:cqu00230]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 429 aa AA seqDB search
MAATITEVGGIKLGKLLIEGKTKQVYDVPSLPGHSILLNKDRITAHNGVRSHDLEGKAQI
SNQTNAKVFTLLNRAGLKTAFVKVVDANAFLARKCDMVPIEWVTRRLATGSYLKRNPGVK
EGFRFAPPKQETFYKDDANDDPQWSEEQIVSAGFKVNGVTIGQDEVDIMRQTTILVFEIL
ERAWGTRNCALIDMKIEFGVDAEGQLLVADVIDSDSWRLWPSGDKRLMVDKQVYRNLASV
SASDLDTVKRNFLWVSEQLDNIAPTNDHLVVVLMGSPSDKDHCEKIAKHCRDLGLNVELR
VTSAHKGTKTTLHIVNEYESVLSNLVFITVAGRSNGLGPVLSGNTNYPVINCPPTRPDNV
QLDVWSSLNLPSGLGCATVLYPEAAALNAAQILGLGNFLIWSKLRVKQLNNYASLIYADK
GFRGVKKAE
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atggccgccaccattaccgaagttggaggaatcaagctgggcaagctgctgatcgagggc
aagaccaagcaggtctacgacgtgccctcgctgccgggccactcgatcctgctgaacaag
gaccgcatcacggcccacaatggcgtccggtcgcacgacctcgagggcaaggcgcaaatc
tcgaaccaaaccaacgccaaggtgtttaccctgctgaaccgggccggcctcaagaccgcc
ttcgtgaaggtcgtcgacgcgaacgcgtttctggcgcgcaagtgcgacatggtgccgatc
gagtgggtgacgcgccgactggcgaccggatcgtacctgaagcgcaaccccggcgtcaag
gagggcttccggtttgcgccgcccaagcaggagacgttctacaaggacgacgccaacgac
gatccccagtggagcgaggagcagatcgtgtcggccgggttcaaggtcaacggggtgacg
atcggccaagacgaggtggacatcatgcgccagacgaccatcctggtgtttgagatcctg
gagcgtgcctggggaacgcgcaactgcgccctgatcgacatgaagatcgagttcggtgtg
gacgccgagggtcagctgctggtcgcggacgtcatcgattcggactcgtggcgcctgtgg
ccatccggcgacaaacgcctcatggtggacaaacaggtgtaccgcaatctggcctcggtg
agcgcctccgacctggacaccgtcaagcggaacttcctctgggtgagcgagcagttggac
aacattgcgccgacaaacgaccacctggttgtggtgctgatgggaagtccctcggacaag
gaccactgcgagaagattgccaagcactgccgcgatcttggactgaacgtggaactgcgc
gtgacctcggcccacaagggaaccaaaacgacgctgcacatcgtcaacgagtacgaaagt
gtcctcagcaatctggtcttcatcaccgtcgcgggacgctccaacggactcggaccggtt
ctgtccggcaataccaactacccggtgatcaactgtcctccgaccaggcccgacaacgtc
cagctggatgtgtggtccagtttgaatctgccctcgggactgggttgtgccacggtgctg
tatccggaagcggccgcgctgaatgctgcgcaaattttggggctgggaaatttcctgatt
tggagcaagttgcgcgtcaagcagttgaacaattacgccagcttgatctacgccgacaag
ggattccgtggggtgaagaaggcggaatga

DBGET integrated database retrieval system