KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ009002Help
Entry
CpipJ_CPIJ009002  CDS       T01079                                 

Definition
(RefSeq) purine biosynthesis protein 6, pur6
  KO
K01587  phosphoribosylaminoimidazole carboxylase / phosphoribosylaminoimidazole-succinocarboxamide synthase [EC:4.1.1.21 6.3.2.6]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu00230  Purine metabolism
cqu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    CpipJ_CPIJ009002
Enzymes [BR:cqu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.21  phosphoribosylaminoimidazole carboxylase
     CpipJ_CPIJ009002
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.6  phosphoribosylaminoimidazolesuccinocarboxamide synthase
     CpipJ_CPIJ009002
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SAICAR_synt AIRC THF_DHG_CYH
Motif
Other DBs
NCBI-GeneID: 6041277
NCBI-ProteinID: XP_001850564
VectorBase: CPIJ009002
UniProt: B0WPD0
AA seq 429 aa AA seqDB search
MAATITEVGGIKLGKLLIEGKTKQVYDVPSLPGHSILLNKDRITAHNGVRSHDLEGKAQI
SNQTNAKVFTLLNRAGLKTAFVKVVDANAFLARKCDMVPIEWVTRRLATGSYLKRNPGVK
EGFRFAPPKQETFYKDDANDDPQWSEEQIVSAGFKVNGVTIGQDEVDIMRQTTILVFEIL
ERAWGTRNCALIDMKIEFGVDAEGQLLVADVIDSDSWRLWPSGDKRLMVDKQVYRNLASV
SASDLDTVKRNFLWVSEQLDNIAPTNDHLVVVLMGSPSDKDHCEKIAKHCRDLGLNVELR
VTSAHKGTKTTLHIVNEYESVLSNLVFITVAGRSNGLGPVLSGNTNYPVINCPPTRPDNV
QLDVWSSLNLPSGLGCATVLYPEAAALNAAQILGLGNFLIWSKLRVKQLNNYASLIYADK
GFRGVKKAE
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atggccgccaccattaccgaagttggaggaatcaagctgggcaagctgctgatcgagggc
aagaccaagcaggtctacgacgtgccctcgctgccgggccactcgatcctgctgaacaag
gaccgcatcacggcccacaatggcgtccggtcgcacgacctcgagggcaaggcgcaaatc
tcgaaccaaaccaacgccaaggtgtttaccctgctgaaccgggccggcctcaagaccgcc
ttcgtgaaggtcgtcgacgcgaacgcgtttctggcgcgcaagtgcgacatggtgccgatc
gagtgggtgacgcgccgactggcgaccggatcgtacctgaagcgcaaccccggcgtcaag
gagggcttccggtttgcgccgcccaagcaggagacgttctacaaggacgacgccaacgac
gatccccagtggagcgaggagcagatcgtgtcggccgggttcaaggtcaacggggtgacg
atcggccaagacgaggtggacatcatgcgccagacgaccatcctggtgtttgagatcctg
gagcgtgcctggggaacgcgcaactgcgccctgatcgacatgaagatcgagttcggtgtg
gacgccgagggtcagctgctggtcgcggacgtcatcgattcggactcgtggcgcctgtgg
ccatccggcgacaaacgcctcatggtggacaaacaggtgtaccgcaatctggcctcggtg
agcgcctccgacctggacaccgtcaagcggaacttcctctgggtgagcgagcagttggac
aacattgcgccgacaaacgaccacctggttgtggtgctgatgggaagtccctcggacaag
gaccactgcgagaagattgccaagcactgccgcgatcttggactgaacgtggaactgcgc
gtgacctcggcccacaagggaaccaaaacgacgctgcacatcgtcaacgagtacgaaagt
gtcctcagcaatctggtcttcatcaccgtcgcgggacgctccaacggactcggaccggtt
ctgtccggcaataccaactacccggtgatcaactgtcctccgaccaggcccgacaacgtc
cagctggatgtgtggtccagtttgaatctgccctcgggactgggttgtgccacggtgctg
tatccggaagcggccgcgctgaatgctgcgcaaattttggggctgggaaatttcctgatt
tggagcaagttgcgcgtcaagcagttgaacaattacgccagcttgatctacgccgacaag
ggattccgtggggtgaagaaggcggaatga

DBGET integrated database retrieval system