KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ009721Help
Entry
CpipJ_CPIJ009721  CDS       T01079                                 

Definition
ubiquitin carboxyl-terminal hydrolase 34
Orthology
K11853  
ubiquitin carboxyl-terminal hydrolase 34 [EC:3.1.2.15]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Brite
Enzymes [BR:cqu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     CpipJ_CPIJ009721
Peptidases [BR:cqu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CpipJ_CPIJ009721
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 4222 aa AA seqDB search
MKRDESRLASNESEHPVFLSKREIEVVIGYIQCWPVRQCMCCYRDPKNFERFNLVVQALV
YFTVYQLKNIRGLLEREEKRCAAAAAAAAALATAAAVPGKDGEDGGKDEATEVAPPVVEE
QLPAPRKDAGGSPVLEDCWTLLDMEKLLLLSSKAFLLNFPLYVAYKHGVHARMDEISPQE
AQSLSIFCDLHDNEIPAFLLRNVSLFCTSGGFDAMMASFDSPNLPVPIAHAITAAISNLK
LWINYRSIIQLFIPIRVKILQYMCKLSDQDLRSPATKAMADFMWTAIKDPLDSQITFDTE
GLALAFKYFTSSTLTMRLAGMAQINAHINLFNEICTTETVAEVEVVGQKLADWLTENQII
SHLFGPNLHVEVIKQSHIVLNFLAVENQITEEHISLIWQAAQLKHCSKPIYDILPSLVKN
LAPRPASHLYSLLSALDPREHTEQSIYIASALTKLIWARDCSRLTLMDLAKNNVLREAAV
AAAAAAAAAREAAELPSSSENSVSVDGSNSEDEPQEEDSSDPEHAAAMAAAAAKANAARH
AARVALAVPSSMPGPSTQQLKSNAPAAATTSAGPSTAPIPAMVAAASMMDATDESDSGVA
VPPPCKQPRHKNCCDGTAGEDNMKVEPGIYNVDQRLKEKMRIPLMSRSMATAASSSSGFP
SMPGVSGAASSNVVGTSSEDDDDDDEEEEDGLGLGLSEAFSAMRKKMLRKKRKKISGLTR
KELQEMASVSDVEDSDLAAMLPDSDCSESNLHHQSSVLRHMAGAVVGPGPMAGPSGAGPS
GSIGPVDDVPPFMGAMAEGHLINFLNATENDGSCSSPLSNKSEKNMGDFDDEDSPCEEEL
VELAARAQCLHQQQFPLPRPRSLGTGMSPQQQPQQRTNTPNITLTRAHHDRLSSTMTPSA
SCSSGGTPTSSSGGKGKLTPTSKTTPPQQIPTKEMLAAAAAAAAAGGLGAPTSPSFRFPD
VCQPGNTLLWDLLQDDKIGQLGESLALEAEKVLGTLLCFHTDKIIRTRFIEGCLQNLAEN
RSVVTSLRLLPKLFASFQQFRDVTTHQVVLWAERHHRMMHHFFNNLKHYTTSGYAVRGSG
GMLYSHVTQIQVRLQFLSSVFSDVGSPRSFKLALGQVDTLWTCLANDPECSDCLFAWLQG
QVKGGDTHALGINAIQHLYLKRLSELKPEGISMVALGLFQQLFMLGREDIIAHPSEGQEA
SDSVGMEHLWKIALRANNTDVSLTAIQYINTYYMEKQLKYENQFVAQCMNHLTQAVEELL
RQGPGSENALMCVQRALMLLNTHLETFRRRYAYHLRRWALEGKEVASHSALRNEGPGPPI
RIVLQPAGVPEKSLLHLHSTDLVADLKAEIAKWWESIQGAVKTAHNETAARTGGTGAVLG
LLLSEGPLRIITQGQEITAEYDERSLADVGFKDNQMVYVSMGSRGGRGRREHHDHPSMLP
PPPKDCLPTLLLLRSPHFEQLFKLMQTLGDMKLIGPGGRIIPNTKAQLLSRRVWDILAML
PTAPTFFNTLKNLTFANSTPEPPPLEPESPDSRRYTLEEILDPHNLQKFMYSLHIVESLC
KSKFMGSCCSSPGGSNSGGPVVPTTSIGVPIAATSGMPGGSRQAIVGPSAAKSLSVKNQL
KLKISTSKSLKMQQNQKQLAAKQQVLGVSNSNLSATTMVSGTSPGKKDRRCDSETEIGEP
KAGSSGEINNKENKSGEACSESTESADQRREVKDEDELNVSVESDNRCAPEQKSPPTIHQ
QPPPKLASPAIASLEWSEQFVKCGGLAHLYRIFVSGVLQKQSSGGGKDGDDLNEWRHDCL
ASLLRILCLLGMEEFRPENENAIIIPKLNRHTLALMEVQPTLERIAGILNEEAQPLSPHH
FKTGLFGRAQVIHYAMNLLVCYAHSLPEVRSTLWKIDANLAWVQRLILDDPEPAVRREAC
AALYRMCLGNAQTYYELMAPLLSKLVALLPLAEKMRPQHQAYHLSPDEGKEPYGPACRDY
FWLLCRLVDSLSPELVKDCGGELSRKPATPGSIGIESMCRQVSKSILDRDYLESRHGSPD
DGLFGLLNLMANLVKFDPQFKFTEEGQQFIGKIFQSLFELPSPDDRDKPKCKSHGARAAA
YDLLVEMCKNAPKNYLLLHGKLMQQHRAGPHSPYPWDYWPRDEGRSECGYVGLTNLGATC
YMASCIQHLFMTPQTRDAILSISTDPQKHKATLYELQRMFAYLMESERKAYCPRSFCRVY
QMDHQPLNTGEQKDMAEFFIDLVSKLEEMTPELKTLVKRVFCGVISNNVVSLDCGHVSRT
LEEFYTVRCQVADMRNLHESLDEVTVKDTLEGDNMYTCSQCGKKVRAEKRACFKKLPQIL
CFNTMRYTFNMVTMLKEKVNTHFSFPMRLDMSGYVEKTLMPHHYQEEKRKSELRRSSSRN
VSESSTSEGGGSGGSLPFSGDDAPLRKEDKVSSSDGQQEQQLPSSSSSSTSSKAEAAEKA
ELQKQQQTLDEEDSEDFNEHYEYDLVGVTVHTGNADGGHYYSFIKERNEDSNPNHQERWF
LFNDAEVKLFDPSQIAAECFGGEMTSKTYDSVTEKYLDFSFEKTNSAYMLFYEWRSNKGT
NIQRDQAERSAAAAAAAAAAAAASCGKPSTFTSAMSMPTATATATSSTVVVTSSSSSIDT
SLPTSLSSTTAVNGSSSSLTSGSSTSVASSSNMTCGTSLSPSASKTELESVEEEEEPMDK
CDKPEVVDVSKKVATPPPLPGPALSLPSTSSTTTNTTREDDQTDPFIPKHPSEVSSVVDN
LSTLSKCDIDVKTSIRSTAAAAGVSLVAPPPPSPLAALQAQASSLSILPPSGPLLGPSML
PSPSYSSISSLSALTATAGGNVGLPLSAVVQQPTISSAALQPCSSSSSSSSTSSSSLGPL
GLGLVVNRIGPPPKRKRKILSKELEEWIWQDNRHFLQDRNIFEHTYFNFMWQICGHIPQT
LLALPDITCIAAQLSVSFFIETFIHAKEKPTMVLWVELLTKQFNASQEACEWFLSHMSAE
PWWPVQVLIQCPNQMVRQMFQRLVIHVIQRLRQCHSALYLKVESDEDGNEIIGNVSCVTR
FIKSLIMLMEHGARAHLRHLSEFFGLLYEFSRMGEEEALFLLRINVIRSVADFYLGHKAA
QDCIDTNSDNEDNSSDEALTVDKSRPASLDKMIALVASLVERSRGPDLRLHLSARDYNAI
AGGKGFPFLYQQIKDNINPHQTRHLIHALCRCDERLAGQIIAMLFTAVTKHTELCGPFFK
LLTLLTESTGGPSGLPCFSQLVLQRVWDAAEYCPQSALDWLAVQAPRNKIAHTWILQSAE
SWVETFLLAHNNARVRNAAAYLLVALVPSQNFRTNYRATSHHKLTMHASSQHREISCEAQ
LILHTILNLLLRLLRSARNYTDISVHGTTKLTAYFNLMTYCLVSKTEKLMLGPHLRALWE
LFHPRLSEPSVPAHHNKQSLLAFWYQATIDCPENALLVANCPDITRNIAFNYILADHDDS
EIVTYNRAMLPVYYGLLRMCCQQSRLLTRQLAAHQNLQWAFKNITPHPTQYPLAVDELFR
LMTLFAQRHADATEAEQREVTIFRRTTLTAYLNGLDARVSWGTLIAALRILVDNDDDRLF
VVLNGGITLCFDALHTLHSMYHEATACHVFGDLQELLAEVILLVSTLRASCREQKKRPPP
ALMKGLPDAVRRLATLLNTFNPPEMRNIALEVLKELVKCAPPEIISTVLVPLLTHCHTQN
VSHPMGPLGSYFPRRGMKATWPPVSKSTPRPPRPMVQMNIPQSQICEKGLDKDFDLALEL
FYRPYHEFLDIMFRVAVTSNQFTEALVHLSLLTGIESVVLHFNIFAKFWVGIFNNKTTNR
YSEMLIKNPLLVDYIDDILRDERLSLNDPVIANFIEIYYPKVKSRLVVPRLLESICQLLP
DKTNLEDICGDLQAIRIIGQRKGIPAAVKALLQGSLHSVLLKFKDEMYSDEETPPKKRKM
ASGSAAIPATQQQQPVVPAATNSEPEQVDPPKVEDAMKASSSEEGTEAKPPQQQEVVNGG
SENGGGTKPDDKVAEVVEEPKKEEEQEKDVPMDEKMDQDGEVEVEKKVEDETKQEGDKTD
KSTEQPTATTDQTKQLSEQELYQRNLIKDIESHIELIFECLDDDDEEERNREGASTGDKS
TEEVAVAADKEESVLEEVATAKAREVTPASCPSPVKIKRRNPSSEEQPAATTTTTTTTVT
KEESQVGAPQVPEDDANRLEST
NT seq 12669 nt NT seq  +upstreamnt  +downstreamnt
atgaagagagacgagtcccgcctggcgagcaatgagtccgaacacccggtgttcctgtcg
aagcgcgagatcgaggtcgtcatcgggtacatccagtgctggccggtccggcagtgcatg
tgctgctaccgcgacccgaagaacttcgagcggttcaacctggtggtgcaggcgctggtg
tacttcaccgtgtaccagctgaagaacatccggggcctgttggagcgcgaggagaagcga
tgcgcggcggccgcagctgcagctgctgccctggcaacggcagctgcggttccagggaag
gacggtgaagatggtgggaaggacgaggcgaccgaagtggcgcccccggttgtggaggaa
cagttgccggctccgcgcaaagatgcaggaggttctccggttttggaggactgctggacg
ctgctagacatggagaagctgctgcttctgtcgtcgaaggcgtttttgctcaatttccca
ctgtacgtggcgtacaagcatggagtccacgcgaggatggacgaaatctcgccgcaggaa
gcgcaaagtttgagtattttttgcgatctgcacgacaacgaaataccggcgtttctgttg
aggaacgtgtcgctgttttgtacttccggagggtttgacgccatgatggctagctttgat
tcgccgaatttgccggttccgattgcgcacgccatcacggctgcgatttcgaacctgaag
ctttggatcaactaccgatcgatcattcaactgttcatcccgattcgggtaaagattctg
cagtacatgtgcaagctgtcggaccaggacctgcgctcaccggctacgaaagcgatggcc
gacttcatgtggaccgccatcaaggatccgctggattcgcagatcacgttcgacaccgaa
ggactcgcgttggccttcaagtactttaccagctcgacgctgacgatgcggttggccgga
atggctcaaatcaacgcccacatcaacctgttcaacgagatctgcacgacggagacagtg
gccgaggtggaggttgtcggtcaaaagctagccgattggctcacggagaatcaaatcatt
tcgcacctgttcgggccgaatctgcacgttgaagtcatcaagcagagtcacatcgtgctc
aacttcctggccgtcgaaaatcagatcactgaagaacacatctcgctcatctggcaggcg
gcccagctgaagcactgctcaaaacccatctacgacattctgccatcgttggtcaagaac
ctggccccacggccggcctcccatctctactcgctcctgtccgcgctcgatccccgcgag
cataccgaacagtccatctacattgcgtccgccctaacgaagctcatctgggcacgggac
tgctctcggctcaccctaatggacctggccaagaacaacgtgctacgagaagcggccgta
gcagcagctgcagctgccgcggccgctcgggaagccgccgaattgccttccagttcggaa
aattccgtctccgtcgatgggagcaacagcgaagacgaaccccaggaagaggacagctcc
gacccggaacatgccgccgcaatggcagctgccgcggccaaagcgaacgctgcacgacac
gccgcacgggtcgccctcgctgtgccttcgtcgatgccgggaccttccacgcaacagctc
aaaagcaacgccccggcagctgcgacgacttcagccggacccagtactgcacccattccg
gccatggttgccgccgccagtatgatggatgcgacggacgaatcggactcgggagtggcc
gtgccgccaccatgcaaacagccacggcacaaaaactgctgcgacggaactgccggtgaa
gataacatgaaagtagaaccgggcatttacaacgtagaccagcgattgaaggagaaaatg
cgcattccgctgatgagtcgctcgatggccaccgctgcttcgtcatcctcgggcttcccg
tcaatgccgggtgtgtccggagcggcctcctccaacgtggttggcaccagcagtgaagac
gacgacgatgacgacgaggaggaagaggacggcctcgggctcggcttgagcgaagcgttt
tccgcgatgaggaaaaagatgctgcgaaaaaagcgcaaaaagatcagcggattgacgcga
aaggagctgcaggagatggccagcgtgtcggacgtggaggacagtgacctggcggcgatg
ctcccagacagcgactgcagcgagtcgaatctgcaccaccagagttcggtgctgaggcac
atggctggggcggtggtaggaccgggaccgatggccggtcccagtggggctgggccgtcc
ggtagcatcgggcccgtagacgatgttccaccctttatgggtgcgatggccgaaggacat
ttgatcaactttttgaacgccaccgaaaacgatggcagctgttcgtcaccgttgagtaac
aaatccgagaagaatatgggcgatttcgacgatgaagattcgccgtgtgaggaggaactg
gtagaactcgctgccagagcccagtgcttgcatcagcaacagtttccactgcccagacca
cgctcgctcggaacgggaatgtccccgcagcagcagcctcaacagcgaacaaacacgccg
aacattacgctgactcgcgctcaccacgatcggctgtcgtccacgatgaccccgagtgcg
tcgtgcagtagtggtggaacgcctacgtcctcctccggtggcaagggcaagcttaccccg
acgagcaaaacaactccaccgcagcagattccaacgaaggaaatgctggcggcggccgca
gcggcagcggcagccggaggtcttggtgcaccaacatcgccgagctttcgctttccggac
gtttgccagccgggaaatacgctgctatgggatctgctacaggatgacaagattggacag
ctgggcgagtcgttggcgctggaagcagagaaggtcctcggaacgctgctgtgcttccac
acggacaaaataatccggacgcgtttcatcgagggatgtctgcaaaacttggcggaaaac
cgcagcgtagtgacgagtttgcgactgttgccgaagctgtttgcgtcgttccagcagttt
cgggacgtgaccacacaccaggtggtgctctgggcggaacgtcatcaccggatgatgcat
cacttcttcaacaatttgaagcattacacgaccagtggatatgcggtgcgtggatccggt
ggaatgctgtattcgcacgtgactcagattcaggtccggctgcagttcctgtcgtcggtg
tttagcgacgtgggatcaccgcgcagtttcaagctggcacttggccaagtggatactctg
tggacctgcctcgcgaacgatcccgagtgcagcgattgcctgtttgcctggctgcaggga
caggtcaagggcggagacacccacgcgcttggaatcaacgccattcagcatttgtacttg
aagcgattgtcagaactgaaaccggaaggaatctccatggttgcgctgggcctgtttcag
cagttgtttatgttgggacgggaagatatcattgctcacccgagtgaaggtcaggaggcg
agtgattcggtcggaatggagcatctgtggaagattgcactgcgagcgaacaacacggac
gtttcgttgaccgccatccaatacatcaacacgtactacatggagaaacagctcaaatac
gagaaccagtttgtggcccagtgtatgaaccatctgacgcaggccgtcgaagaactgctg
aggcaaggtccgggctcggagaatgcattgatgtgcgttcaacgtgccctaatgctgctc
aacactcacctggagacgttccgacggaggtacgcgtaccatctccgacggtgggctctc
gagggcaaagaggtcgcatcgcacagtgcacttcgcaacgaagggccgggtccgccaatt
cgtattgtgctgcaacctgcgggtgtgccggaaaaatcccttcttcacctgcactcgacc
gatttggtcgcggatttgaaggccgaaatcgccaaatggtgggaatcgatccagggagcg
gtcaaaacagctcacaacgaaaccgcagcacgaaccggtggcaccggagccgtgttgggt
ctgctgcttagcgaaggtccactccggatcatcacccagggtcaggaaatcaccgccgag
tacgacgaacgaagtctcgccgacgtgggcttcaaggacaaccagatggtgtacgtgtcg
atggggagtcgcggaggccgaggtcgccgagaacatcacgatcatccgtcgatgctgcca
ccgccaccgaaagactgtctaccgacgttgctgctgctgcgaagtcctcactttgagcaa
ctcttcaagctgatgcaaaccctcggcgatatgaagctaatcggccccggaggtcgcatc
attcccaataccaaggcacaactgctctctcggcgcgtttgggacattctagctatgctc
ccgactgcgcccaccttcttcaacacgctcaaaaatctaaccttcgccaactccacccca
gaaccaccaccactcgaaccggaatcaccggactctcgccggtacacgctcgaagagatc
ctcgatccacacaacctacagaaattcatgtactcgctgcacatcgtcgaaagcctttgc
aagtccaagtttatgggcagctgctgcagcagtcccggcggaagcaacagcggaggaccc
gtcgtccctacgacctcaatcggtgttcccatcgcggccacctccggaatgccgggtgga
tcccggcaagccatcgtcggtccgagtgccgccaaaagcctttcggtgaagaaccaactg
aagctcaaaattagcacgtcaaaatcgctcaagatgcagcagaaccagaaacagctggcg
gccaagcaacaagtgctgggcgtaagcaatagcaacctgtcggcgaccacgatggtaagc
ggaacttcaccgggcaagaaggatagacgatgcgattcggagacggagattggagaacca
aaggcgggaagttccggtgagattaacaacaaggagaacaaaagcggcgaggcttgtagt
gagtcaacagaaagtgccgaccagaggcgggaggttaaggacgaagacgagctgaacgtg
agcgtggagtcggacaatcgctgtgctccggagcagaaatccccaccgacgatccaccag
cagccgcctcccaagttggcaagccccgcgattgcgtccctcgagtggagcgagcagttt
gtcaagtgtggcggcttagcacacctgtaccggatcttcgtttccggtgtgctacagaaa
caatccagcggcggaggcaaggacggtgatgatctgaacgagtggcgccacgactgtcta
gccagtttgctccgaattctgtgtctgctcggtatggaagagttccggccggaaaacgaa
aatgcgatcatcattccgaagctgaaccggcacacgctggcactgatggaggtgcagcca
acgctggagcggatagcgggtattttgaacgaggaggctcaaccgttgagtccacaccac
ttcaagacgggtctgtttgggcgagcccaagtgatacattacgcgatgaacttgctggtg
tgctacgcccactcgctgccggaggtgcggtcgacgctgtggaagattgacgccaacttg
gcttgggtgcaacggttgatcctggacgatccggaaccggcggtacggagagaggcctgc
gcagcactgtaccggatgtgcctgggaaatgctcagacctattatgaattgatggctccg
ctgctttcaaagctggttgcgttgctaccactagcagagaagatgcgtccccaacaccaa
gcgtaccatctatccccggacgagggcaaagaaccgtatggaccggcgtgtcgagactat
ttctggctgttgtgtcgattggtagactcgttgtctcccgagctggttaaagattgcgga
ggagaactcagccgtaagccagcgactcccggttcgatcgggatagaatccatgtgtcga
caggtgtccaagagcattctcgatcgagactacctcgaaagtcgccacggtagtccggat
gatggcttgtttggtctgctcaatttgatggccaatctggtcaagttcgatccgcagttc
aagttcaccgaagaaggtcagcagtttatcggcaagatattccaatcgctgttcgagttg
ccctcgccggacgatcgggacaaaccgaaatgcaaaagtcacggagctcgagccgcggcg
tacgatctgttggtggaaatgtgcaagaatgcccccaagaattacctgctgctgcacggc
aagttgatgcaacagcaccgagctggaccccactcaccgtacccttgggactactggcca
cgggatgagggccgttccgagtgtggctacgttggacttaccaatctgggcgcgacctgc
tacatggcgtcctgtatccagcacctcttcatgacaccccaaacgcgcgatgccatcctg
tccatctcaacggacccgcaaaagcacaaagcaaccctgtacgaactgcagcggatgttc
gcctaccttatggaatccgaacgcaaggcgtactgtccgcgatccttctgccgggtctac
caaatggaccaccagccgctcaacacgggcgagcagaaggacatggccgagttcttcatc
gatttggtctccaaactggaggagatgacgccggagctgaagacgctggtcaagcgagtg
ttttgcggagtcatcagcaacaatgtggtgtccttagactgcggccacgtcagccgaacg
ctcgaggagttttacacggtgcgttgccaagtcgcggacatgcgcaacctgcacgaatcg
ctggacgaagtcaccgtcaaggataccctcgaaggggacaacatgtacacgtgctcacag
tgcggcaaaaaggtccgcgcggagaagcgagcctgcttcaagaaacttccgcagattctc
tgcttcaacacgatgcgctacacgttcaacatggttacgatgctcaaagaaaaggtcaac
acgcactttagcttcccgatgcgactcgacatgagcgggtacgtcgagaagacgctgatg
ccccatcactaccaggaggagaaacgcaagtccgaactgcgaagatcttcgtcgcgaaac
gtcagcgaatcgagcacttccgagggaggcggcagcggtggcagtttacccttcagcggt
gacgacgccccgctccgaaaagaggacaaagtcagctcgagtgacggccagcaggagcag
caactcccgtcgtcgtcttcgtcttcgacgtcgagcaaagccgaagcggcggagaaggcc
gaattgcagaagcagcaacagacgctagacgaggaagactcggaggatttcaacgagcac
tacgagtacgacctggtcggagtgacggtacacacggggaacgccgacggtggccactac
tacagcttcatcaaggagcgcaacgaggacagcaatccgaaccaccaggagcgctggttc
ctgtttaacgacgccgaggtgaaactgttcgacccgtcccagattgcggcggagtgcttc
ggcggtgagatgacgagcaaaacgtacgattcggtcacggagaaatatctggactttagc
ttcgagaagaccaactcggcgtacatgctgttttacgagtggcgctcgaacaagggcacc
aacatccaacgtgaccaggcggaacgttcggcggcggcagcagctgctgcggctgcggcc
gctgctgccagttgtggcaaaccgtccacgtttacatcggccatgtccatgccgactgcg
accgcaacggcaacgtcgtcaacggtggtcgtcactagtagcagcagtagcattgacacg
tcactcccgacgtccttgtcgtctacgacggcggtaaacggaagtagcagtagtttgacc
agcggtagcagtaccagcgttgccagcagctccaacatgacctgtggcacgagtctgtcg
cccagtgctagcaagacagagctggaatcggtcgaggaggaagaagaaccaatggacaag
tgcgacaagccggaagtggttgatgtttcgaagaaagtggccactcctccgcccttacct
ggcccagcactatcactaccaagcaccagcagcaccacgacaaacaccacccgtgaagat
gatcagactgacccatttatcccgaaacatcctagtgaagtatcatcggtagtagataat
ttaagtactctaagtaaatgtgatatagatgttaagactagcattagaagtactgctgcc
gccgccggagtgtcccttgttgcgccaccaccgccgtccccgctggccgccctccaagcg
caggcctcttcactgagcatcctgccgccgtcgggaccgctgctaggaccttcgatgctt
ccctcgccgtcctactcgtcaatttcgtccctgtcggcacttacggccaccgccggtgga
aacgttggccttccccttagtgccgtcgtgcagcagcccaccatttccagtgccgccctc
caaccgtgctcatcttcgtcgtcttcatcgtccacttcctcgtcctcactgggaccactc
gggctggggctggtcgtcaaccggataggtcctccaccgaagcgaaagcgtaaaatcctg
agcaaagaactggaagagtggatctggcaggacaaccgacactttttgcaggatcgcaac
atcttcgagcacacctacttcaacttcatgtggcagatttgtggccacattccgcagacg
ctgcttgcgctaccggacattacctgtatcgctgcgcagttgtcggtttcgtttttcatc
gagacgtttatccacgccaaggagaagcccacgatggtgctttgggtggagctgctgacg
aaacagttcaacgcgagccaggaggcgtgcgagtggttcctcagtcacatgtccgccgag
ccgtggtggcccgtccaagtgctgatccagtgccccaaccagatggttcggcagatgttc
cagcggctggtgattcacgtgatacagcggttgagacaatgccacagcgcactctatctg
aaagtggagtcggacgaggacgggaacgagatcatcggcaacgtgtcctgcgttacgcgc
ttcatcaagtcgttgattatgctgatggagcacggagcgcgagcccacctgcgacatctg
tccgagttcttcgggttgctgtacgagttctcgcgaatgggtgaagaggaggcgctgttc
ctgttgcgcatcaacgtgatccggagcgtggcagatttctaccttgggcacaaggcggcc
caggattgcatcgataccaactcggacaacgaggacaactcgtcggatgaagcactcacc
gtggacaagagtcgtccggcgtcgctggacaagatgattgctctggtggcgtcacttgtg
gaacgatcgcgtggacctgacctcaggcttcacctttcggcgcgggactacaatgcgatt
gccggtggaaagggctttcccttcctgtaccagcagatcaaggacaacatcaacccgcac
cagacgaggcatctcatccacgcgctctgccgatgtgacgaacggctggccggtcagatc
attgcgatgctcttcactgccgtaaccaagcacaccgagctgtgtggaccgttcttcaag
ctgctaacactgctcacggaatctaccggtggtccctcgggcctaccttgcttctcccag
ctcgttctacagcgggtttgggacgcggccgagtactgtccccagtcggccctggactgg
ctggcggttcaagcgccccgtaacaagatcgctcacacctggatcctccagtcggccgag
agttgggtcgagaccttcctgctagcgcacaacaacgcccgcgtacggaacgccgcagcg
tacctgctcgtggcgctcgttccatcgcagaacttccgcaccaactaccgggccacgtcg
caccacaaactgaccatgcatgccagctctcagcaccgggaaatctcctgcgaagcgcaa
ctcatcctgcatacgatactcaaccttttgctgaggttgctgcggtccgcccggaactac
accgacattagtgttcacggcacgaccaagctgacggcgtacttcaatctgatgacgtac
tgtctggtttcgaagacggaaaagttgatgctcggaccacatcttcgcgccctgtgggag
ctgttccatccgcggctatcggaaccgtccgttccggcgcaccacaacaagcagtcgctg
ctggcgttctggtaccaggccacgatcgactgccccgagaacgcgcttctggtggccaac
tgtccggacatcacgcgcaacattgcatttaactacatacttgccgaccacgacgactcg
gagattgtcacgtacaaccgggccatgctgccggtgtactacggcctgctgcggatgtgc
tgccagcagagcagactcctaacgcgccagctggctgcccaccagaacctgcagtgggcc
ttcaagaacatcacaccccatccgacgcagtacccgctagccgtggacgaactgttccgg
ttgatgaccctgtttgcgcagcgtcatgcggacgcaacggaggccgagcagcgcgaggtg
accatctttcggcggactacgctgacggcgtacctcaacgggttggacgcacgcgtttcc
tgggggacgttgatagcggcgcttcggatactggtggacaacgatgacgatcggttattc
gtagtcctcaacggcggcatcacactttgcttcgatgcgttgcacacgcttcactcgatg
taccacgaagcgaccgcctgtcacgtgtttggcgacctgcaggaactgctcgccgaagtg
atcctcctcgtcagcaccctgcgagctagctgtcgcgagcagaagaaacgacccccgcca
gcgctcatgaagggcctcccggacgccgtccgacggctagcaaccctgctcaacaccttc
aacccaccggagatgcgtaacattgcgctggaggtgctcaaggagctcgtcaagtgcgct
ccgccggagatcatcagcacggtgctggttccgctgctcacccactgccacacccagaac
gtttcgcacccgatggggccactagggtcgtatttcccgcgacgtggcatgaaggcaacg
tggccaccagtttccaagagtacaccgcgtccaccccgaccgatggtgcagatgaacatt
ccgcagtcgcagatttgcgaaaagggactcgacaaggactttgacctggcgctggagctg
ttctaccggccgtaccacgagttcctggacattatgttccgcgtggcggtcacctcgaac
cagtttacggaagcgctcgtgcacctatcgctgctgaccggcatcgagtccgtcgtgctg
cactttaacatctttgccaagttctgggttggcatctttaataacaagacgactaatcgg
tactctgaaatgctaatcaagaatccattgctggtggattacatcgacgacatcctgcgg
gacgagcggctctcgctgaacgatccggtcattgcgaactttatcgaaatctactaccca
aaggtcaagtcccggctggtggtgccgcggctgctcgagtccatctgtcagctgctgccg
gacaaaacgaacctggaggacatttgcggcgacttgcaggcgatccggatcattggtcag
cgcaagggcatcccggcggcggtcaaggcgctgctgcagggatcgctgcactcggtgctg
ctcaagttcaaggacgagatgtacagcgacgaggaaaccccaccgaagaagcgaaagatg
gcaagcggttcggcggcgatcccggccacccagcagcagcaaccagttgtgccagctgcg
acaaattccgagccggaacaggtcgacccaccgaaggtggaagacgcaatgaaagcctcg
agttcggaggaggggaccgaggcgaaaccaccacaacagcaggaggtcgtcaacggagga
tcggagaacggtggagggacgaaaccggacgacaaggtcgcggaagttgttgaggagccg
aagaaggaagaggagcaagagaaggatgtgccgatggacgagaaaatggatcaggatggc
gaggttgaggttgagaagaaggttgaggacgagacaaagcaagagggtgacaaaacggac
aagtcaaccgaacaaccgacggcgacgacggatcagacgaagcagctgagcgagcaggag
ctgtaccagcgcaatcttatcaaggacattgagagccacatcgagctgatatttgagtgt
ttggacgatgacgatgaggaggagcggaatcgcgagggtgcatcaacaggtgacaaaagc
acggaggaggtcgcggtcgcagccgacaaggaagaatcagtgcttgaggaagtggcgaca
gcgaaggccagggaggtcacaccggcgagttgtcccagcccggtcaagataaagcggagg
aatccgtccagcgaggaacagccggccgcgacaacgacgacgacgacgacgacggttacg
aaggaagagtcccaggtgggggcgccacaggtgccagaggacgatgcgaatcgactggaa
tcgacgtaa

DBGET integrated database retrieval system