KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ009966Help
Entry
CpipJ_CPIJ009966  CDS       T01079                                 

Definition
sphingosine kinase a, b
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    CpipJ_CPIJ009966
Enzymes [BR:cqu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     CpipJ_CPIJ009966
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 350 aa AA seqDB search
MFMDYTKEFEPFETKPILASALTVVKGKHSMLDIVRVETRSHIMFSFLSVGWGLISDIDI
ESERLRAIGGQRFTLWSVHRLISLRTYQGKVSYIPALVNPSHPYHRSNSLPRDGGGGHGG
LGGAAGIGLKHSISYNTTLDCQDCRTADEENCDACDTNFSDVLSLETGSNLETFRPRIDS
WYSATSRKSTYFSTQDSIYESDRASNEGTTVGTNQMYGPPSRLPALTAPVPDTWKSLAGE
FVMVHAAYQTHLSTDCFFAPLSKLNDGIIWLLIIKAGASRAQLLSFMLGLGTGTHMPTQE
NEYIQMVPVTAFRIEPVGTTGHMTVDGEDVEYGPIQAEIFPSLARVMVPK
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgttcatggactacaccaaggaatttgaaccgttcgagacgaaaccgatcctggcatca
gctttaaccgtagtcaaaggcaaacattccatgttagatatagtgcgagtggagacacgt
tctcatataatgttctcattcctgtcggtcggctggggcctcatctcggacatcgacatc
gagagcgagcggctgcgggccatcggcggccagcggttcacgctctggtccgtccaccgg
ttgattagcctgcgcacctaccagggcaaggtgtcctacattccggcgctggttaatccg
tcccatccgtaccaccggtccaactcgttaccccgggacggtggtggcggccacggtggc
ctcggtggtgccgccggtatcggcctcaagcatagcataagttacaacaccacgctggac
tgccaggactgtcggacggcggacgaggaaaactgtgatgcttgcgacaccaactttagt
gacgtgctgtcgctcgagacggggagtaacctggagacgttccggccgcgcatcgacagc
tggtactcggccacgtcccgcaagagcacttacttttcgacgcaggacagcatctacgag
agtgatcgggcttccaacgagggcacgacggtggggacgaaccagatgtatggacctccg
tcgcggcttccggcgttgacggcacccgtgcccgacacgtggaagtcgcttgccggagag
tttgtgatggtgcacgcggcctaccagacgcaccttagcacggattgcttttttgcacca
ctttccaagctgaacgacgggatcatttggctgttgataattaaggccggtgccagccgg
gcccagctgttgtcctttatgctgggtcttggcactgggacgcacatgccaacgcaggag
aacgagtacatccagatggtgccggtgacggcgttccggatcgagccggtcgggacgacg
gggcacatgacggtggacggggaggatgtcgagtatgggcccatccaggcggagatcttt
cctagtttagcgcgggttatggttccgaaatga

DBGET integrated database retrieval system