KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ010175Help
Entry
CpipJ_CPIJ010175  CDS       T01079                                 

Definition
cytochrome P450 9b1
Orthology
K15003  
cytochrome P450, family 9 [EC:1.14.-.-]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 534 aa AA seqDB search
MEVNIVYPLAVVAILVWFYHRLTRVYGYFHEKPIPSMAAKPMFGSTKPVLTKKCSFNEFI
KKIYDQYEGVKCFGLFDAKQRFFVLRDPELIKKVAVKDFDHFVDRRPMFGDRTSENSNIM
FLKTLVGLKDQKWRDMRGTLSPAFTGSKMRAMFELITEYSERMVQVVRGEAAGAGYVDQE
MKDFFRRIANDIIATCAFGLQVESFKNRNNEFFTMGKEMLNFKRAFVIFRMIAFKLFPGI
MSKLNHDIIGKKQLEYFTRIIRDTVETREARGIVRPDMIQLLMEARKGTLKHQQESSNTG
AGFATVEESHIGQATSNRAITEPELIAQCLIFFLAGFDTISTVFTFMAYELALNQDVQHK
LHQEVVQTNDLLKGKPLTYDVLQTLTYLDIVVSECLRKWPAPAIDRLCVKDYVLDDGEGL
KFTIDKGACVWFPVHGIHRDPKYYPDPERFNPERFSETNRASINPAAYMPFGVGPRNCIG
SRFALMEIKAIVYQLLLSFSFERTEQTEVPIQLAKGFVNLASVNGVHLRLKLRV
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atggaggtaaacatcgtgtacccgttggcggtcgtcgccatcctggtctggttctaccac
cggttaacccgggtctacggctacttccacgagaaaccgatcccgtcgatggctgccaag
ccgatgtttggtagcaccaagcccgtgctgacgaagaagtgttcgttcaacgagtttatc
aagaagatctacgaccagtacgagggtgtcaagtgtttcggcttgtttgacgccaagcag
cgattcttcgtgctgcgtgatccggagctgataaagaaggtggctgttaaagattttgac
catttcgttgatcggcggccaatgtttggggatcgaacgagtgagaattccaacatcatg
ttcctgaaaacgcttgttggattgaaggaccagaagtggagggatatgcgaggaacgctg
agtccggcctttactggaagcaagatgagagccatgtttgagctgatcacagagtacagt
gagcgaatggtacaggtcgtgaggggtgaagctgctggagcgggatacgttgatcaggag
atgaaggactttttcaggaggatcgcgaacgatatcatcgctacgtgtgcgttcggattg
caggtcgagtcgttcaagaatcgcaacaacgagttcttcacgatgggcaaggagatgttg
aacttcaagcgagcgtttgtgatctttcggatgattgcgttcaagctgttcccgggaatc
atgagcaagctcaaccacgacatcatcggtaagaaacagttggagtactttacgcggatc
atccgagacactgtggaaacgcgcgaagctcgaggaatcgtccgcccagatatgatacag
ctgttgatggaagctcggaaaggtacgctaaagcaccaacaagaatcttccaacaccgga
gccggtttcgcaacggtggaagaatcccacatcggccaggcaacctcgaacagagcgata
acagaaccagaactcatcgcccagtgtctgatcttcttcctggccggattcgacacaatc
tccacggtgttcaccttcatggcttacgagttggccctcaaccaggacgtccaacacaag
ctccaccaagaagtggtccaaaccaacgaccttctcaaaggtaaacccctcacgtacgac
gtcctccaaacactgacctacctggacatagtcgtttcggaatgcctccggaagtggccc
gccccggcaatcgatcgactctgcgtcaaagactacgtcctagacgacggcgagggcctc
aagttcaccatcgacaaaggggcctgcgtgtggttccccgtgcacggcatccatcgagac
cccaaatattaccccgacccggagcgattcaacccggagcggttcagcgagacgaaccgg
gcgagcatcaacccggcagcttacatgccgttcggagttggcccaaggaactgtatcggg
tcgcgttttgcgctgatggagattaaggcgatcgtgtaccagctgctgttgagctttagc
tttgagcggacggagcagacggaggtgccgattcagttggccaaagggttcgtcaatttg
gccagcgtgaatggggtgcatcttaggttgaagttgagggtgtag

DBGET integrated database retrieval system