KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ010268Help
Entry
CpipJ_CPIJ010268  CDS       T01079                                 

Definition
Dual specificity tyrosine-phosphorylation-regulated kinase
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 551 aa AA seqDB search
MHPEMFLTQRGSGTTRRSTEDWLQKNTYLPFIRSISPTSSTDIRAMQARIPSHFRDPATA
PLRKLSVDLIKTYKHINEHYRFGLYHLYGTSGDKDKDMGLGRRKLLMLSFFKRTRENSPG
ILKQIGEVDARWVYYAKKKRRAQQTQGEDTSHKKERKLYNDGYDDENHDYIIKNGEKFLD
RYEIDSLIGKGSFGQVVKAYDHEEECQVAIKIIKNKRPFLSQAQIEVNLLEMMNRADAEN
KYYIVKLKRHFMWRNHLCLVFELLSYNLYDLLRNTNFRGVSLNLTRKFAQQLCTALLFLS
SQELNIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGIP
YDLAIDMWSLGCILVEMHTGEPLFSGSNEADQINKIVEVLGMPPKHILDQAHKTRKFFEK
LSDGSYVLRKTQNQRKYKAPGSRKLHDILGVETGGPGGRRHGEPGHSVSDYLKFKDLILR
MLDYDPKTRCTPYYALQHNFFKRTSDESTNTANTAISSSSLSTSPSVSSSTAQQPLQQQQ
QDPSSHGKALL
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgcatccggaaatgttcctgactcaacgcggcagcggcaccacgcgccgctctacggaa
gactggttacagaagaacacttacctgccgttcatccgttcgataagtcctacatcatcg
accgacatccgggcgatgcaagcccggataccatcgcatttccgggaccccgcgacggca
ccgctgcggaagctcagcgtcgacctgatcaaaacctacaaacacatcaacgagcattat
aggtttggtctctaccatctctacggtacttcaggggacaaggacaaggatatgggatta
ggtcgacggaaattgttgatgctctccttttttaagaggacaagggaaaattcccccggc
attctcaagcagattggtgaggtcgatgcgagatgggtttactatgccaaaaagaaacga
agagctcaacaaacccagggcgaggacacgtcccacaagaaggaacggaagctgtacaac
gacggctacgacgacgagaaccacgactacatcatcaaaaatggcgagaagtttctcgac
cgctacgagatcgactccctcatcggcaaaggcagcttcggccaggtggtcaaggcgtac
gaccacgaggaggagtgccaggtggcgatcaaaatcatcaaaaacaagagacccttcctg
agccaagcacaaatcgaggtgaacctgctggagatgatgaaccgggcggacgcggagaac
aagtactacatcgtcaagctgaagcggcactttatgtggcggaatcatctctgtttagta
ttcgagctgctgtcctacaacctatacgacttactgcgcaatacgaacttccgcggcgtg
tcgctgaacctgacgaggaagtttgcccagcagctgtgtacggcgctgttatttttaagt
tcacaagaattaaatatcatacactgtgatttaaaaccagaaaatatattattatgtaac
cccaaacggtcagcaattaagatagtagattttggcagttcatgccaactaggacaaagg
atatatcaatacatacaatcacgcttctaccggtcgcccgaggtgctgctggggatcccg
tacgacttagcaatagacatgtggtccctcgggtgcatcctggtcgagatgcacaccggc
gagccgctcttctccggctcgaacgaggccgaccagatcaacaagatcgtcgaggtgctc
gggatgcccccgaagcacatcctcgaccaggcgcacaaaactcgcaagttcttcgagaag
ctctccgacggcagctacgtgctgcggaagacgcaaaaccagcgcaagtacaaggcgccc
ggctcgcgcaagctgcacgacatcctcggcgtggaaacgggcggcccgggcggccggagg
cacggcgagcccggccacagcgtgtccgactacctaaagttcaaggatctgatactgcgg
atgctggactacgacccgaagacgcgctgcacaccgtactatgccttgcaacacaacttc
ttcaagcgaacgtcggacgagagcaccaacacggcgaacacggccatcagcagcagctcg
ctcagcacgagtccgtcggtcagcagcagtacggcgcaacaacccctgcagcagcagcag
caggacccaagcagtcacggtaaggcgttactttga

DBGET integrated database retrieval system