KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ010268Help
Entry
CpipJ_CPIJ010268  CDS       T01079                                 

Definition
Dual specificity tyrosine-phosphorylation-regulated kinase
Orthology
K08825  
dual specificity tyrosine-phosphorylation-regulated kinase 1 [EC:2.7.12.1]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Brite
Enzymes [BR:cqu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     CpipJ_CPIJ010268
Protein kinases [BR:cqu01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   CpipJ_CPIJ010268
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 551 aa AA seqDB search
MHPEMFLTQRGSGTTRRSTEDWLQKNTYLPFIRSISPTSSTDIRAMQARIPSHFRDPATA
PLRKLSVDLIKTYKHINEHYRFGLYHLYGTSGDKDKDMGLGRRKLLMLSFFKRTRENSPG
ILKQIGEVDARWVYYAKKKRRAQQTQGEDTSHKKERKLYNDGYDDENHDYIIKNGEKFLD
RYEIDSLIGKGSFGQVVKAYDHEEECQVAIKIIKNKRPFLSQAQIEVNLLEMMNRADAEN
KYYIVKLKRHFMWRNHLCLVFELLSYNLYDLLRNTNFRGVSLNLTRKFAQQLCTALLFLS
SQELNIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGIP
YDLAIDMWSLGCILVEMHTGEPLFSGSNEADQINKIVEVLGMPPKHILDQAHKTRKFFEK
LSDGSYVLRKTQNQRKYKAPGSRKLHDILGVETGGPGGRRHGEPGHSVSDYLKFKDLILR
MLDYDPKTRCTPYYALQHNFFKRTSDESTNTANTAISSSSLSTSPSVSSSTAQQPLQQQQ
QDPSSHGKALL
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgcatccggaaatgttcctgactcaacgcggcagcggcaccacgcgccgctctacggaa
gactggttacagaagaacacttacctgccgttcatccgttcgataagtcctacatcatcg
accgacatccgggcgatgcaagcccggataccatcgcatttccgggaccccgcgacggca
ccgctgcggaagctcagcgtcgacctgatcaaaacctacaaacacatcaacgagcattat
aggtttggtctctaccatctctacggtacttcaggggacaaggacaaggatatgggatta
ggtcgacggaaattgttgatgctctccttttttaagaggacaagggaaaattcccccggc
attctcaagcagattggtgaggtcgatgcgagatgggtttactatgccaaaaagaaacga
agagctcaacaaacccagggcgaggacacgtcccacaagaaggaacggaagctgtacaac
gacggctacgacgacgagaaccacgactacatcatcaaaaatggcgagaagtttctcgac
cgctacgagatcgactccctcatcggcaaaggcagcttcggccaggtggtcaaggcgtac
gaccacgaggaggagtgccaggtggcgatcaaaatcatcaaaaacaagagacccttcctg
agccaagcacaaatcgaggtgaacctgctggagatgatgaaccgggcggacgcggagaac
aagtactacatcgtcaagctgaagcggcactttatgtggcggaatcatctctgtttagta
ttcgagctgctgtcctacaacctatacgacttactgcgcaatacgaacttccgcggcgtg
tcgctgaacctgacgaggaagtttgcccagcagctgtgtacggcgctgttatttttaagt
tcacaagaattaaatatcatacactgtgatttaaaaccagaaaatatattattatgtaac
cccaaacggtcagcaattaagatagtagattttggcagttcatgccaactaggacaaagg
atatatcaatacatacaatcacgcttctaccggtcgcccgaggtgctgctggggatcccg
tacgacttagcaatagacatgtggtccctcgggtgcatcctggtcgagatgcacaccggc
gagccgctcttctccggctcgaacgaggccgaccagatcaacaagatcgtcgaggtgctc
gggatgcccccgaagcacatcctcgaccaggcgcacaaaactcgcaagttcttcgagaag
ctctccgacggcagctacgtgctgcggaagacgcaaaaccagcgcaagtacaaggcgccc
ggctcgcgcaagctgcacgacatcctcggcgtggaaacgggcggcccgggcggccggagg
cacggcgagcccggccacagcgtgtccgactacctaaagttcaaggatctgatactgcgg
atgctggactacgacccgaagacgcgctgcacaccgtactatgccttgcaacacaacttc
ttcaagcgaacgtcggacgagagcaccaacacggcgaacacggccatcagcagcagctcg
ctcagcacgagtccgtcggtcagcagcagtacggcgcaacaacccctgcagcagcagcag
caggacccaagcagtcacggtaaggcgttactttga

DBGET integrated database retrieval system