KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ010349Help
Entry
CpipJ_CPIJ010349  CDS       T01079                                 

Definition
ubiquitin specific protease
Orthology
K11837  
ubiquitin carboxyl-terminal hydrolase 6/32 [EC:3.1.2.15]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Brite
Enzymes [BR:cqu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     CpipJ_CPIJ010349
Peptidases [BR:cqu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CpipJ_CPIJ010349
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 1755 aa AA seqDB search
MLVQRQLASEPVMPGNFRYKCYFSFLWTLYCNESGTHILKQDFQKAIQIETTYQNAPATT
GTTNKSNSLPGTAKYTVALFGPNDRVTFEQFKSWIQIYKGATVLSKWLLQDACVNLSSEL
ETPTFYQSLAGVTHLEEQDIGVLEKVFWLLKGLALTGQLDLESLGPLISPPVPKAALGGV
FLAFDENHDGHIDFKELCCGVSAACRGPNVERSKFCFKVFDIDRDGVLNYGEVGKMVDIL
LFVAKETNAACYKSVTSGQVMEELYRRALDGSGGDGAKLDVPDPVPEFKFTQEDFLIWSI
ESSRNLVQPFLDLLFEVCHIVLGLRPQCKHLEGDIVRGWLAREVRRGYKVGQFWYLVSSD
WWQHWQQYTQPSVTSSCVHCKVASSYANSRSNAVGGSGMPGVDEAVICDESFTSNSTESM
GDLLNTGGDSSSLGSGSSGISCGRQPGGPPGVIDNGNLIAPVMYKQIPTLTGEGGRLKRD
LTLVQHRDFELVPDSLWKALSQWYDGPLPLPRQVIQPLSSAEVELELYPLNLRILRHQNP
PAQQQQQQQSNSTWGSISGGYGALTSAGQGYPTVSSVLQPPKKYLAYTAAFSRLATVKQV
AEFLCQRLKLRVEDIRLWHLVPTPTGVTEFPYLLEEDILTLQELSIADNDQLLLEIRNKD
LTWPEELGSLTIAHSNSHTNLERRGTVSSIHSQHPPGATGLHNLGNTCFMNAALQVLFNT
QPLAQYFAKRMHLYELNVNNKLGTKGQLAMRYAELLREVWTASQRSIAPLKLRFCVTKHA
PQFSGGGQHDSQELLDWLLDSLHEDLNRVMEKPYSELKDSDGRADVVVAAEAWSQHHARN
QSIIVDLFYGQLKSKVTCSGCGRDSVRFDPFSLLSLPLPVENYTYCEVLVSLLDGSVPVK
YGLRLNSEQKYWDLKKALGEMCGLEPELLLICELSNSQIRCILPNEQKIKPSTACSPLYV
YELPKFDNVLARSRAGSELAINIEKGLKDIQRTPEPNQLTTCSAITTISSSSSSASTATV
DDPTVAMTGSGRQQAKTVGQGNNRRTSATATATTASKETLQNIPEISASPDSTFIFSESA
ATQYAGLAPERNRKQPAVPTATSTNQQLLNNNNNVAVVENGGWNVDEQDAASCSDCDIMY
NGLGTGPGDSGSFNHHLHHNHRDSFNQSAIKRPPSAGSGGGIYPPTSKSPANYLIAVHRK
LSRQDTYFLSHHKSRPGLFGVPLLIPCYDGVTNKELYCSVWLQVARLLSPLPPTPPDQSN
HATDCDDSLGYDFPFTLRAVASGGRICALCPWSRFCRGCEIPCNDEPLLQGLIYSGHSSS
NNSTPNLSSREQTPTFRRKTYGSSTTSSLDGVVPAPQLQQQSSPTPSLSRSINTTSIQIA
IDWDPTALHLRYQSTRERLWTEHESVAICRRQQTEPVDLDHCLRAFTSEEKLEQYYHCSH
CKQKKPATKKLQIWKLPPILIVHLKRFNFVNNKWVKSQKVVNFPYEDFDPTPYLASVPQE
TILRHKELLEGGGPHGLNHDCHDEFLEFDREMSMIDEVSDEVSISSITGTIESGGNGEGE
DGEEGDDDYEDEGSSNGRTAELNSITPAIAGTHPVAWARQEVGDESPSKAKSRMSAKTKA
QRKRLVSSSLTKTPVIDGQFTDFHNHHLKPERDAFDLKYQLYAAVCHSGMLNGGHYISYA
ANPNGSWYCYNDSSCREIPTRPKIDPSTAYLLFYERRDLDYEPYLPKVEGRQVPTEHLAE
FEESDNELKKLCTLM
NT seq 5268 nt NT seq  +upstreamnt  +downstreamnt
atgctggtgcagcgccagttggccagtgagccagtgatgccaggaaactttcgctataaa
tgctacttttcattcctctggacgctgtactgcaacgagtccggcacgcacatcctgaag
caagacttccagaaggccatccaaatcgaaaccacgtaccaaaatgcccccgccaccacc
ggcaccacaaacaagagcaacagcctgcccggcaccgccaagtacacggtggcgctgttc
ggtccgaacgatcgcgtcacgttcgagcagttcaagtcgtggatccagatctacaagggc
gccacggtgctgtccaagtggctgctgcaggacgcgtgcgtgaatttgagctcggagctg
gagacgcccacgttctaccagagtttggcgggggttacgcacctggaggagcaggacatt
ggcgtgttggagaaggtgttttggctgttgaaggggttggcgttgacggggcagctggat
ctggagtcgctggggccgctgattagtccaccggttccgaaggcggcgctgggtggtgtg
tttttggcgttcgatgagaaccacgatggacacattgactttaaggagttgtgttgtggg
gttagtgcggcgtgtcgggggccgaacgttgagcggagcaagttttgcttcaaagtgttt
gatatcgatagggacggggtgttgaactacggggaggttgggaaaatggtggacattttg
ttgtttgtggccaaagagacgaacgcggcgtgttacaagagcgttaccagtgggcaggtc
atggaggagttgtataggagagcgttggatgggagtggcggtgatggggcgaagttggac
gttccggatccggtgccggagtttaagtttacgcaggaagatttcctgatttggagtatc
gagagcagccggaacttggtgcaaccttttttggatctgctgtttgaagtgtgtcatatt
gtgctggggttgaggccgcagtgtaaacacctggagggggacattgtgcggggttggttg
gcgcgggaggttcggcggggctacaaagtgggccagttttggtatttggtgtcgtcggat
tggtggcagcactggcagcagtacacgcaaccttcggtgacttcgtcgtgcgttcactgt
aaggtggcgtccagttatgcgaatagtcggagtaatgccgttggtggatccgggatgccc
ggggtggatgaagcggtcatttgtgacgagagttttacctcgaactcgaccgagagcatg
ggagatttgctgaacacgggaggtgattcgtctagtctgggctccgggagcagtggaata
tcgtgcggaaggcaaccgggtggaccgccgggagtgattgataacggcaacttgatagcg
ccggtcatgtacaagcaaataccaacgctgaccggtgaaggaggacgactgaagcgggat
ttgacgctggttcagcatcgagactttgagctcgttccggactcgctgtggaaggcttta
tcgcagtggtacgatggaccgcttccgctgccgaggcaggtgattcaaccgttgagttcg
gcggaagtcgagctggagttgtacccgttgaacttgaggatattgcgccatcagaatcca
cccgcccaacagcagcaacagcaacaatcaaacagtacctggggaagcatctcgggaggt
tacggcgcgttgacctccgccggacagggctacccgacggtgtcctcggtgctgcaacca
cccaagaaatatctcgcctacacggcagccttcagccgactggccaccgtcaaacaagtg
gccgaattcctctgccaaagactgaaactcagggtcgaagacatccggttgtggcacctg
gtccccaccccgaccggtgtcaccgagttcccctacctgctggaagaagacatcctcacg
ctgcaggagctgtccatcgcggacaacgatcagctgctgctggaaatacgaaacaaagat
cttacctggccagaggagctgggatcgctcacgattgcccacagcaacagccacaccaac
ctggaacgccgcggaactgtctcctcaatccactcgcaacatccccctggcgccaccgga
cttcacaatctcggcaatacctgcttcatgaacgccgcgctgcaagtcctgttcaacacg
caacctctcgcgcaatactttgccaagcggatgcacctctacgagctgaacgtcaacaac
aagctgggtaccaaaggccaactcgcgatgcgttacgcggaactcctccgcgaagtctgg
accgcctctcaacgctcgatcgccccgctcaagctgcgattctgcgtcaccaaacacgcg
ccccagttctccggcggtggccaacacgactcccaggaactgctcgactggctgctcgac
tcgctgcacgaagatctgaaccgcgtcatggagaagccgtacagcgagctgaaggactcg
gacggccgggccgacgtcgtggtggcggccgaagcctggagccaacaccacgcccgcaac
caaagtattatcgtcgatctgttctacggccagctcaagtccaaggtgacgtgctccggg
tgtggccgcgactcggtgcggttcgatccgttcagtttgctcagcttgccgctgcccgtc
gaaaactacacgtactgcgaggtgttggtctccctcctggacggttccgtcccggtcaag
tacggcctgcggctcaactcggagcaaaagtattgggatctgaagaaggcgctcggcgaa
atgtgcggcctcgagccggaactgctgctcatctgtgaactgtccaactcgcagatccgc
tgcattctgcccaacgagcagaagatcaaaccgagcacggcctgctcgccgctgtacgtg
tacgaactgcccaagttcgacaacgtcctggcacgttcccgggccggctccgaactggcc
atcaacatcgagaagggcctcaaggacatccaacggacgccagagccgaatcagctaacg
acctgctcggccatcacgaccatctcgtcgtcgtcgtcgtccgcctcgacggccaccgtg
gacgatccgacggtggcaatgacgggcagtggccgtcaacaggccaagacggtaggccag
ggtaacaatcggcggacatcggcgacggcgacggcgacgacggcatcgaaggaaacgtta
cagaacattcccgaaatcagtgccagcccggacagcacgttcatctttagtgaatcggcc
gctactcagtacgccggtttggcccccgaacggaaccggaagcaaccggcggtgccaacc
gcgaccagcaccaaccaacagctgctgaacaacaacaacaacgtggccgtagtcgagaac
ggcggctggaacgtggacgagcaggacgccgcctcctgtagcgattgtgatattatgtat
aatggcctcggcacagggcccggggacagcgggtccttcaaccaccaccttcaccacaac
caccgggattcgttcaatcaaagtgcaattaagcgaccgccgagtgccggaagtgggggc
ggaatctacccgccaacgtccaaaagtcccgccaactatctgattgccgtgcatcggaag
ctcagccggcaggacacgtactttctgtcgcaccacaagtcccggcccgggctgttcggg
gtgccgctgctgattccgtgctacgacggcgtcaccaacaaggagctgtactgctcggta
tggctgcaggtggcccggctgctgagtccgctgccgccgacgccaccggaccaatcgaat
catgccacggactgtgatgatagcttagggtacgacttcccgttcacgctacgagcggtc
gccagcggcggtcgcatctgcgccctctgcccgtggtcccggttctgccggggctgcgaa
atcccctgcaacgacgaaccactgctgcagggcctgatctactcgggtcactcgtcaagt
aacaactcaacgccgaatctgtcctcgcgagaacaaacgcccacgttccggcggaaaacg
tacggcagctcgacgacgtcgtcgctggacggagtagtcccagcgccccagctgcagcag
cagtcttcgccgacgccctcgctcagtcggtccatcaacacgaccagcatccagattgcc
atcgattgggacccgacggcgctgcacttgcggtaccagagtacccgggagaggctatgg
accgagcacgagtcggtggccatctgccggaggcagcaaacggaaccggtcgacctggac
cactgtctgcgggcgttcacctccgaggaaaagctggaacagtactaccactgttcgcac
tgcaagcagaagaagccggcgacgaagaagctgcagatttggaagttgccaccgattttg
attgtccacctgaagcggttcaactttgtgaacaacaagtgggtcaagtcgcaaaaggtc
gtcaacttcccgtacgaagacttcgacccaacgccgtatctggcgtcggtcccgcaggaa
acgatccttcgccacaaggagttgctcgaaggtggtggtcctcacggcctcaaccacgac
tgtcacgacgagtttctcgagtttgaccgggaaatgtccatgatagacgaggtcagcgac
gaggtgtccatctcgtccatcacggggacgattgagagtggcggaaatggtgagggagaa
gatggtgaagaaggggacgatgattacgaggacgagggcagcagcaacggcaggacagct
gagttgaatagtattacgccggccatcgccggaacgcatccggtggcctgggcgcgacag
gaagtgggcgacgaaagtccgagcaaagccaagtcacggatgagcgccaaaacgaaagcc
caacgcaagcgactcgtttcgtccagcctgaccaagacgccggtcatcgacggacagttt
acggactttcacaaccaccacctcaaaccggaacgcgacgcgttcgatctaaagtatcaa
ctgtacgccgcagtgtgtcactcgggcatgctgaacggcggccactacatctcgtacgcg
gccaacccgaacggctcgtggtactgctacaacgacagctcctgccgggagattccgacg
cggccaaagatcgaccccagtacggcgtacctgctgttttacgagcggcgtgacctcgac
tacgagccgtacctgcccaaggtggagggccgccaggtgccgacggagcatctggccgag
ttcgaggagagcgacaacgagctgaagaagctgtgcacgctcatgtag

DBGET integrated database retrieval system