KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ010541Help
Entry
CpipJ_CPIJ010541  CDS       T01079                                 

Definition
cytochrome P450 9b2
Orthology
K15003  
cytochrome P450, family 9 [EC:1.14.-.-]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Brite
Enzymes [BR:cqu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.-  Acting on paired donors with incorporation of molecular oxygen
    1.14.-.-  
     CpipJ_CPIJ010541
Cytochrome P450 [BR:cqu00199]
 Cytochrome P450, animal type
  CYP9 family
   CpipJ_CPIJ010541
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 541 aa AA seqDB search
MLQVDLFTACAVGGIVLLVYHYLSKKFEYFLSKPIPCPKPTFLFGNTASMILRTQDAKEK
IQELYNSFPDAKIMGFYNLLKPAFIVRDPEVIKKIGVKDFDYFMEHTPIFSPSKTDADDD
NSQSLFGNSLFALRGQKWRDMRATLSPAFTGSKMRHMFDLVAECGVSLKEFLLKEAKTGK
RMEYEMKDTFSRFGTDVIATVAFGLKVDSMREQDNEFFTKGKKMLDVKSPKVLIKFLTVV
AFPWLARKLDIDLVDGKLATYFRGVLTGHMKQREAHGIVRNDMINILMEVQKGALRHNAE
EHETKDAGFATVEESSVGKSTHSRVWTESELIAQCFLFFFAGFDTVSSGMSFLAYELALS
PEVQDRLYQEIMETDQFLAGKPLNYDTLQKMEYLDMVVSEALRKWPPAVLSDRLCSKDYQ
YDDGQGTSFVIEKNRTIWIPTIAIHNDPKFYPNPDKFDPERFSPENRSKIVPGTYLPFGI
GPRNCIGSRFALMELKSIMYYLVKEFSLEPTDRTEVPLKLSRMAISLQSEKGIWLELKPR
K
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgctacaggtggatctgtttacggcgtgtgccgttggtggaatcgttctactcgtgtat
cactatctgtcgaaaaagttcgaatacttcctgtcgaagccgataccatgcccgaagccg
acgtttctttttgggaataccgcatccatgatattgcggactcaggatgccaaagagaag
attcaagagctgtacaatagctttcccgacgcaaagattatgggcttttacaacctcctc
aagcctgccttcatcgtacgcgatccggaagtgattaagaagatcggcgtcaaagatttc
gactacttcatggagcacaccccaatatttagtccgagcaaaacagatgcggatgacgat
aacagtcagagcctcttcggaaactcactgtttgctctacgagggcaaaagtggcgggat
atgcgagcaaccctgagtccggccttcaccggaagtaagatgcgccacatgttcgacctg
gtagcggaatgcggagtatcgttgaaagagtttctgctgaaggaagctaagacggggaag
agaatggagtacgaaatgaaggataccttctcgagatttggaacggacgtaattgcgacg
gtagcatttggattgaaggtggattcgatgcgtgaacaggacaatgaattcttcacgaag
ggaaagaaaatgcttgatgtgaaatcgccaaaagtgttgataaaattcttgacggtggta
gcctttccatggttggcacgcaagctggacattgatcttgttgacggaaaactggccacg
tacttccgaggagtccttacaggacacatgaagcaacgtgaggcgcatggaatcgtcaga
aatgacatgatcaacattttgatggaagttcagaaaggtgcattgcgacataacgccgag
gagcacgaaacgaaggatgcaggattcgcaacggtagaggaatccagtgtaggaaaatcg
acccactcaagagtttggaccgaaagtgaactgattgcgcagtgctttttattctttttt
gctggctttgacacagtgtcttccggaatgagtttcttggcttacgagctcgccttgagt
ccggaggtccaagatcgcctctatcaagaaataatggagacagatcaatttcttgctggg
aagccactcaactacgatactcttcagaagatggaatacttggatatggtagtttcggaa
gcactacgaaagtggccaccagcagtcctttccgatcgactctgcagcaaggactatcag
tatgacgatggtcagggtacgagttttgtgattgaaaagaatcgcaccatatggattccc
acgatcgccattcacaacgaccccaagttctaccccaacccggataaattcgacccggaa
aggttcagcccggaaaaccgatcgaagatagtccctggaacttatttgccgtttggaata
gggccaaggaactgcattggatcccgtttcgccctgatggagctgaagtcgattatgtac
tatctagtgaaggagttcagtctggagccgaccgataggactgaggtgccactaaagctc
tcccggatggcgatttcgttacagtcggaaaagggcatctggctggagcttaaacctcgg
aaataa

DBGET integrated database retrieval system