KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ010556Help
Entry
CpipJ_CPIJ010556  CDS       T01079                                 

Definition
hypothetical protein
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    CpipJ_CPIJ010556
Protein phosphatases and associated proteins [BR:cqu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     CpipJ_CPIJ010556
Ubiquitin system [BR:cqu04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     CpipJ_CPIJ010556
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 704 aa AA seqDB search
MAMLTRGGAVAVSTWFNCHFQAAIWHCLNHYDYQDAIFLAERLCAEVESEESLFLLATCY
YRAGQKHQAHWLLSTKSVRSTQCRFLLSKCAFDLKQYSEAEHTLINDDHLRARHLDEVAK
EFGEIGCFALELLSKICLKTEQAKLANDASRRAVKLNPFMWQSFADLCNRGEKPDPAAVF
QLSSTDVFATSQAPHPALNSSVMWFGNAGSGGGGGGGGGGTLLEESLIGGGLGGHPSTPI
DQVSQCLIQNIINTPNNPPQQQPQSHQQSSIASFRTASSTMATGGNLSDEQTPNADIGTP
FRKQQFKYLTALSPTTPSFGVLPIMHSPATIGDQSALIMTPSPQQLSTATGGTFQQIGGS
AAAIGGSQQSQQIIPESEQQKMALLSSNKKLRGHHNLGTMGNIINRKNDATAATMLLQSQ
SANTKPILFSQTGNQLPTPRTPNTTGGALQAQNVRRSSRLFSNSNYSVKENTKSPQLNNK
FVAPRSPPRKSKQRISKNLNSSTNSLLENVVERKGSTDGKEKIETITSNETLSEKVLFNN
SINSAQKMAQHVLAMKKQSADGLMTLLRELGQGYLRLQSYDCDKAIDAFSNVSPHHYTSS
WVQSMIALAYHEQRDYESAVNIFREIHEREPHRLQYMEIYSTDLWHLQKDVVLSALAQDL
MAQDKNSPITWCVAGNCFSAHKEHETAIKFFFRAIQVSLGLLRV
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atggccatgcttactcgaggcggtgctgttgctgtttcaacatggttcaactgtcatttc
caggccgcaatatggcactgcctgaaccattacgactaccaggatgccatcttcctggcg
gaacgcctctgtgcggaagtggaatccgaggagagtctgttcctgttggcgacctgctac
taccgggccggccagaaacaccaggcccactggctgctgtcgacgaagagcgtccgctcg
acgcagtgccggttcctgctgtccaagtgtgccttcgatctgaagcaatattccgaggcg
gagcacacgctgatcaacgatgaccacctgcgggctcggcacctggacgaggtcgcgaag
gagtttggcgagattggttgcttcgcgttggagctgctgtcgaagatttgtctcaagact
gagcaggcaaagctggcgaacgatgccagccggagggcggtcaagctgaacccgtttatg
tggcaatcgtttgccgatctgtgcaaccggggtgaaaagcccgacccggccgcggtcttc
cagctgtccagtacggatgtatttgcgactagccaagcgcctcatccggcactcaactcg
tcggtcatgtggttcgggaatgctggcagcggtgggggaggaggaggaggaggaggaggg
acattactggaagagtcacttattggaggtggccttggcggtcatccgtctacgccgatc
gatcaggtttcacagtgtctgattcagaacattatcaatacaccaaataatcctccacaa
cagcaacctcagtcccatcagcagagcagtatagctagcttccggacggcatcgtcgacg
atggccaccggagggaatctcagtgacgagcagacgccaaacgcggacatcggaacgccc
ttccgaaagcagcagttcaaatatctgaccgcgttgagtccgacgacacccagctttggc
gtgcttccaatcatgcatagtccggcgacaatcggagatcagtcggcactcataatgacc
ccctcgccgcagcagctatccacggccaccggtggaaccttccagcagatcggaggatcg
gcagcggcgataggcggcagtcaacagtcgcagcaaattattcccgaaagcgaacagcaa
aaaatggctctgctgagcagcaacaagaagctgcgtggccatcacaacctcggaacgatg
ggcaacatcatcaaccggaagaacgacgcgacggcggcgacgatgctgctgcagtcgcaa
agtgcaaacaccaaaccgatcttgtttagccaaaccggcaaccagctgccgacgccgcgg
acacccaacacgacgggtggagccctccaggcgcagaatgtccgccgaagctcgcgcctc
ttcagcaacagcaactattccgtcaaggagaacaccaaaagcccccaactcaacaacaaa
ttcgttgcgcccaggtcacctcctcgcaagtccaaacagcgcatctccaaaaacctcaac
agcagcaccaacagtctgctggagaacgtcgtcgagcggaaagggtcaaccgacggcaaa
gaaaaaattgaaaccattacgtcgaacgagacgctcagcgagaaggtcctgttcaacaac
agcatcaacagtgcccaaaagatggcccagcacgtgctggccatgaagaagcagagtgcc
gacggactgatgaccctccttcgagaactcggccagggctacctccgactgcagagttac
gactgcgacaaggccatcgatgccttctccaacgtgtccccccatcactacaccagcagc
tgggtccaaagtatgatcgccctggcgtaccacgagcagcgtgactacgagtcggccgtc
aacatcttccgggagattcacgagcgcgaaccgcaccggctgcagtacatggagatttac
agcacggacctgtggcacctgcagaaggacgtggtgctgtcggcgctggcccaagatctg
atggcccaggacaagaactcgcccatcacgtggtgcgtggccgggaactgcttttccgcc
cacaaggagcacgagacggccatcaagttcttctttcgtgcaatacaggtgagtttgggg
cttttgcgggtttga

DBGET integrated database retrieval system