KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ010590Help
Entry
CpipJ_CPIJ010590  CDS       T01079                                 

Definition
disulfide-isomerase TXNDC10
Orthology
K09585  
thioredoxin domain-containing protein 10 [EC:5.3.4.1]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Brite
Enzymes [BR:cqu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     CpipJ_CPIJ010590
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 420 aa AA seqDB search
MRIRTTFAATTADSSRVLELSDRFLDVRNEGQWFVKFYAPWCAHCKKLEPVWAHVAQALY
NTNIRVGRVDCTRFSAVAQAFRVSAYPTIMFIKGPYDYVYTGDRTKEDLLHFVNRMSGPP
VQQVTRPDSIDILKANNPIFFTYVGKQDGILWDVFYSAAESYQPHGYFYATSVEIAKRHF
GIDTVPAALVYKERSHYYFPYSDNFDLLEPAHLNESLFRWVNEERFPTFPKVTRSNIHHI
VQTKKYLVLAVVEENKLSEIAAHEQEFRDMVEIFVHKNKQKYHGRFQFGWVGTPDLAHSI
AMDTLATPHLIVLNASTNEHHIPEDDPLQLTPEAIELFLDSIHNQTAPTFGGNSLPVRIY
RAWFEAKTSLYDMWLGNPVLTSVLFGLPLGFLSLIFYSICCADILDAEEEEDEPRHEKKE
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgcgaattcgcacaaccttcgccgccacgaccgccgacagttcgcgggtgcttgagctt
agcgaccgcttcctagacgtccggaacgagggccagtggttcgtgaagttctacgcgccc
tggtgcgcacactgcaaaaagctggaaccggtgtgggcccacgtagcgcaggccctgtac
aacaccaacatccgggtgggccgggtcgactgcacccggttctcggccgtggcccaggcg
ttccgcgttagcgcctacccgacgattatgttcatcaagggaccgtacgattacgtttac
accggggatcgcaccaaggaggatttgcttcactttgtgaaccgcatgtcgggaccgccg
gtgcagcaggttacccgcccggacagtatcgacatcctcaaggcgaacaacccgatcttc
ttcacgtacgtgggcaagcaggacggaatcttgtgggacgtgttctacagtgctgcggag
tcgtatcaaccgcacggatacttttacgccacgtcggtggagattgccaagaggcacttt
ggcattgataccgtcccggcggcgttggtttacaaggagcgcagccattattacttcccg
tactcggataactttgacctgctcgagccagctcacctcaacgagtcgctctttcggtgg
gtcaacgaggagcgtttcccgaccttcccgaaggtgactcgcagcaacatccaccacatt
gtgcaaacgaaaaagtatctagttttggcagtggtcgaggagaacaaactaagtgaaatc
gctgcgcacgagcaggagttccgcgatatggtggagatctttgtgcacaagaacaagcaa
aagtaccacggccggttccagtttggatgggtcggcacgcccgatttggcccactcgatt
gcgatggacacgctggccacaccacatctgatcgtcctgaacgcaagcaccaacgagcac
catattccggaggacgaccccctccagctgaccccggaggcgatcgagctgttcctggac
agtattcacaatcaaaccgcaccgacgtttggtggaaattcgcttccggtgcgcatctac
cgggcctggttcgaggcaaagacgtccctgtacgacatgtggctcggcaatccggtgctg
acatcggttctatttgggcttccgctgggctttctatcgctgatattttactcgatttgc
tgtgccgacattctggacgccgaagaggaagaggacgaaccaaggcacgagaagaaggag
taa

DBGET integrated database retrieval system