KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ010611Help
Entry
CpipJ_CPIJ010611  CDS       T01079                                 

Definition
dual specificity mitogen-activated protein kinase kinase 4 MAPKK4
Orthology
K04430  
mitogen-activated protein kinase kinase 4 [EC:2.7.12.2]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 388 aa AA seqDB search
MAETNQNTNQEHGMFLPLDANYNNRKRPQKKLSFQPSPVPTITSRTPPLSDKTRDRIKMQ
ATGKLQIAPNQIYDFTADDLIDEGEIGRGAFGAVNRMKFIRTDTVMAVKRIRSTVDEKEQ
KQLLMDLEVVMKSNDCNTIVTFYGALFKEGDCWICMELMDTSLDKFYKFICECQHDRIPE
SILCQITLATVRALNYLKEELKIIHRDVKPSNILLKRNGDIKLCDFGISGQLVDSIARTK
DAGCRPYMAPERIDPQRAKGYDVRSDVWSLGITLMEVATGKFPYPKWGSVFEQLSQVVEG
DPPRLSPSYNGMEFSTDFVNFVNTCLIKDEKDRPKYGKLLQHPFVQRAEKSHTDVSAYVG
EVLESMANNGITPFTTNLPAERWNESFN
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaacgaaccagaacactaatcaggagcacggaatgttcctgccgttggatgcc
aactacaacaaccggaagcgaccgcagaagaagctgagcttccagccgagtcccgttccg
accatcacgagtcgaacgcccccgctgtcggacaaaactcgggaccggatcaagatgcag
gccaccggaaagctgcagattgcaccgaaccagatctatgactttaccgcggacgacctg
atagacgaaggcgaaatcggacgtggggcgttcggcgcagtcaatcggatgaagttcatc
cggacggacacggtgatggcggtgaagcggatccggtccacggtcgacgagaaggagcag
aagcagctgctgatggatctggaggtggtgatgaagtccaacgattgcaacaccatcgtc
acgttctacggtgcactgttcaaagagggcgactgctggatctgcatggagctgatggac
acgtcgctggacaagttttacaagttcatctgcgagtgccagcacgaccgcatcccggag
tcgattctgtgccagattacgctggccacggtgcgagcgctaaactatctgaaggaagag
cttaagattatccatcgggacgtgaaaccgagcaacattctgctgaagcgaaacggcgac
atcaagctgtgcgactttggcatctccggccagctggtggactcgatcgcgcgtaccaag
gacgccgggtgtcggccgtacatggcgccggaacggatcgacccgcagcgggcaaagggt
tacgacgtgcgcagtgacgtctggtcgctcggcatcacgctgatggaggtggccaccggc
aaatttccctatcccaagtggggctccgtgttcgagcagttgtcacaggtcgtcgaaggt
gaccccccgcggctgtccccgtcgtacaacggcatggagttctccaccgatttcgtcaac
tttgtcaacacatgcctgatcaaggacgaaaaggaccgacccaagtacggcaagctgctg
cagcacccgttcgtgcagcgggccgaaaagagccacacggacgtgtcggcgtacgtcggc
gaggtgctggaatcgatggccaacaacggcatcacgccgttcaccacgaacctgccggcc
gagcgctggaacgagagcttcaactaa

DBGET integrated database retrieval system