KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ010637Help
Entry
CpipJ_CPIJ010637  CDS       T01079                                 

Definition
hypothetical protein
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    CpipJ_CPIJ010637
  Metabolism of other amino acids
   00480 Glutathione metabolism
    CpipJ_CPIJ010637
Enzymes [BR:cqu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     CpipJ_CPIJ010637
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 190 aa AA seqDB search
MENPSFLRFGLDGALLPSKYSQNVLASSAAPKTVYDFSAVDIDGNKVSLDRYRGHVLIIV
NVASKCGYTDGHYSELNQLYEEYGESKGLRILAFPSNQFANQEPQTNEQIKKFAQEKKGA
KFDLFSKIYVNGDETHPLWQFLKEKQGGTLFDAIKWNFTKFIVDKNGNPVERHGPQTSPL
ELKKNLEKYF
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacccaagtttcttacggtttggtctggacggagcgctattaccatccaaatat
tcccaaaacgttctggcctcctccgccgcccccaagaccgtgtacgattttagcgccgtg
gacatcgacggcaacaaggtctcgctggaccgctaccggggccacgtgttgattatcgtg
aacgtggcctccaagtgtggctacaccgacggccactactcggagctgaaccagctgtac
gaggagtacggtgaatcgaagggtctccgcattctggcgttcccgtcgaaccagttcgcg
aaccaggagccgcaaaccaacgagcagattaaaaagttcgcccaggagaagaagggcgcc
aagtttgatctgttctccaagatttacgtcaacggggacgaaacgcacccgctgtggcag
ttcctgaaggagaagcagggcggcaccctgttcgatgccatcaagtggaactttaccaag
tttatcgtggacaagaacggcaacccggtggagcgccacgggccgcaaacgagcccgctc
gagctgaagaagaacctggagaaatacttttga

DBGET integrated database retrieval system