KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ010988Help
Entry
CpipJ_CPIJ010988  CDS       T01079                                 

Definition
ubiquitin carboxyl-terminal hydrolase 7
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.1.2.15]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    CpipJ_CPIJ010988
Enzymes [BR:cqu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     CpipJ_CPIJ010988
Peptidases [BR:cqu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CpipJ_CPIJ010988
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 1106 aa AA seqDB search
MDYDKTVEAMDTQDDNELDPPNVQALAPTTVVNPANGGGGGAVTAGPEQMNMDDQDNLDD
EVRSEATFSFKVENLSKLTDSVLSQAYYVRNLPWKIMAMRRTNDTTSPPSKGLGFFLQCN
GESDTANWSCSASAELRLLSVIPNRDPFVRKIRHVFSRVENDWGFSFFMNWNDILNPENG
YIQNDAITLEVHVTAEPPRGIFWDSKKHTGYVGLKNQGATCYMNSLLQTLYFTNQLRKAV
YKMPTEADDDCKSVALALQRVFHDLQTQSKPVGTKKLTKSFGWDALDSFMQHDVQEFLRV
LLDKLENKMKGTSLEGTIPKLFEGKMISYIKCQNVDYTSRRTETFYDIQLNIKGKKNINE
SFKDYIATEILDDDNKYDAGEHGLQKAEKGILFSKFPPVLHLHLMRFQYDPITDSSVKFN
DRFEFDEKINLDPFLEKPEDTSATYILHAVLVHSGDNHGGHYVVYINPKNDGKWCKFDDD
VVSRCTRNEAIEQNYGGHDNDLNIRHSSNAYMLVYVRESTIHEVLEDVKSTDISDELQER
LDEQRRIQQCRRTERTEATNFMNINVLLEDYMEIYQKSDLFDPATATYRTFKVRKSTTIS
ELAGMFSKAFKVEPDKMRMWTVSKNGLRIHKFQLIDANTNETCSKYGYQDPKNSWTIFLE
MASPETNQLKPIEQNDLLIFFKSYDPAEKRLNYCGHGFFKTFRFLSDEYFQEECRKRAHY
EPDTEIRLYEVTDINKAVKMQEFFVIDSALSLPINGSIIIIEKVSAGEVESYEFPTCEEY
LKDLYCRIEVLFVDTLNPNDSGFTLDLSSESNYEQIAKACGRRINVDPYEIQFFKCKNFS
EIPGQPLPHNYSGTLKDILCYTKAKTVRKLFYQKLSISINELENKKQFRCLYLMPNLKEE
KELILYPNKNGTVASLLAEAAKVIEFHENSTKVLRISELSKNRLAPGPAKDTPLDQLHDY
TDNTFVQRTTISNQKMYRIEEVAEDELNPAENEMLVPVLHFTKDIGSIFGIPFFIRTVHQ
ETFATLKERMKKKLNVSDKEWEKYKLAIITEHIDYIDDETIEINLEMFKPDLADPNSRTY
LGLEHINKNTKRSRFSNMEKAIKIYN
NT seq 3321 nt NT seq  +upstreamnt  +downstreamnt
atggactacgataagaccgtagaagcaatggatacgcaagacgataacgagttagatccc
ccgaacgtgcaggcgctggccccgacgacagtggtaaacccagcgaacggaggtggtggc
ggagcagtgaccgctggtcccgaacagatgaacatggacgatcaggacaatctggacgac
gaggtccggtcggaggcgacctttagctttaaggtggagaatctaagcaagctgacggat
tcggtcctgtcgcaggcgtattatgtgcgcaatctgccctggaagataatggccatgcgg
cggaccaacgacacaacgtcgccgcccagcaaaggacttggctttttcctgcagtgtaac
ggcgaaagtgacaccgcaaactggagctgttcggcgtcggccgagctgcggctgctgtcg
gtcatcccgaaccgggatccgttcgtgcgcaagatccgtcacgtgttcagtcgcgtcgag
aacgattggggcttttcgttctttatgaactggaacgacatcctcaacccggagaacggt
tacatccagaacgatgccatcacgctggaagtgcacgtcacggctgagcctccgcggggc
attttctgggactcgaagaagcacaccggctacgtgggcctcaagaaccagggagcgacc
tgttatatgaactccctgctgcaaacgctctattttacgaatcaactgcgtaaagccgtg
tacaagatgccaaccgaagcggacgacgactgcaagtcggtcgcgctggcactgcagcga
gtgttccacgatctgcaaacccagagcaaaccggttggcaccaaaaaactaaccaaaagc
ttcggctgggacgcgctggactcgttcatgcagcacgacgtgcaggaattcctccgcgtg
ctgctcgacaagctggaaaacaaaatgaagggcaccagcctggagggaaccatcccgaag
ctgttcgagggcaaaatgatctcgtacatcaagtgtcagaacgtggactacacgagccgt
cgcacggaaacgttctacgacatccagctgaacatcaagggcaaaaagaacatcaacgag
tccttcaaggattacatcgcgacggaaatcctcgacgacgacaacaagtacgacgcgggc
gagcacggtctgcagaaggccgagaagggcatcctgttcagcaagttcccgcccgtgctg
catctgcacctgatgcgctttcagtacgaccccattacggacagttccgtaaagtttaac
gaccggttcgagttcgacgagaagatcaacctggacccgttcctggagaagcccgaggac
acgtcggccacgtacatcctgcacgccgtgctcgtgcactccggggacaaccacggcggc
cactacgtggtgtacatcaacccgaagaacgacggcaagtggtgcaagttcgacgacgac
gtggtgtcgcggtgcacgcgcaacgaggcgatcgagcagaactacggcggccacgacaac
gacctgaacatccggcacagcagcaacgcgtacatgttggtgtacgtgcgcgagtccacg
attcacgaggtgttggaagatgtcaagagcactgacatttcggacgagctgcaggagcgg
ctggacgagcagcgccggattcagcagtgtcgtcgtacagagcgcaccgaggcgaccaac
tttatgaacatcaacgtgctgctggaggattacatggagatctaccagaagtcggatttg
ttcgatccggctacggcaacgtaccggacgtttaaggtgcgcaagagcaccaccatttcg
gagctggccgggatgttctcgaaggcgtttaaggtggagccggacaagatgcgcatgtgg
accgtgtcgaagaacgggctgaggatacacaagttccagctgatcgacgcgaacacgaac
gaaacgtgcagcaagtacggctaccaggatccgaagaactcgtggacgatctttctggag
atggcctcgccggagacgaaccagctgaagccgatcgagcagaacgacctgctgatcttt
ttcaagtcgtacgatccggccgagaagcgcctgaactactgcgggcatggcttcttcaag
acgttccggttcctgtcggacgagtatttccaggaggagtgtcgcaagcgagcccactac
gagccggacacggagatccggctgtacgaggtgacggacatcaacaaggcggtcaagatg
caggagttcttcgtgattgactcggcgctgtccctcccgatcaacggttcgatcatcatc
atcgagaaggtgagcgcaggcgaggtggagagctacgagttcccgacgtgcgaggagtac
ctcaaggatctgtactgccggattgaggtgctgttcgtggacacgttgaaccccaacgac
tccggctttacgctggatctgtcgtcggagtccaactacgagcagatcgccaaggcttgc
ggacgaaggatcaacgtggatccgtacgaaattcagttcttcaagtgtaagaactttagc
gaaatccccggccagcctctgccccacaactacagcggaacgttgaaggacatcctgtgc
tacaccaaggccaagacggtgaggaaactgttctaccagaagctatcgatcagcatcaac
gagctggagaacaaaaagcagttccgctgtctatatctgatgcccaacctcaaggaggag
aaggagctcattctgtacccgaacaagaacggtaccgtggcgagcctgctggcggaagcg
gccaaggtgatcgagttccacgagaacagcaccaaggtgctgagaatatccgagctgtcc
aagaaccgactcgcgcccggacccgccaaggacactcctctggaccagctgcacgactac
acggacaacaccttcgtacagcggaccaccatcagcaaccagaagatgtaccgcatcgag
gaggtcgccgaggacgagctgaacccggccgagaacgagatgctcgtgccggtgctgcat
ttcaccaaggacatcggtagcattttcggcattcccttcttcatccggaccgtgcaccag
gaaaccttcgccacgctcaaggagcgcatgaagaaaaagctaaacgtctcggacaaggag
tgggaaaagtacaagctggccatcatcaccgagcacattgactacatcgacgacgaaacg
atcgagatcaacctggagatgttcaagccggacctggccgatcccaactcgcggacgtac
ctcgggctggaacacatcaacaagaacaccaagcgaagcaggtttagcaacatggagaag
gcgatcaaaatctacaattag

DBGET integrated database retrieval system