KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ011260Help
Entry
CpipJ_CPIJ011260  CDS       T01079                                 

Definition
phosphoglucomutase
Orthology
K01836  
phosphoacetylglucosamine mutase [EC:5.4.2.3]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CpipJ_CPIJ011260
Enzymes [BR:cqu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.3  phosphoacetylglucosamine mutase
     CpipJ_CPIJ011260
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 550 aa AA seqDB search
MTFNLRQVYAFAREYHQKRDSQKEIQYGTAGFRSHADNLDYVMYRMGLLAVLRSRAKGGQ
VIGVMITASHNPEQDNGVKLVDPMGEMLEQSWERLATDLVNVSDADLEGQIAKISTEQGI
DNNEPAKVYVGMDTRYHSPQLAKAVLNGIAALKGSVRDFGIVTTPMLHYFVTCSNTDLAY
GLPTEEGYMTKLLTAFKRIRGNTFAKGNYTNKVFYDGANGVGSLKMLGFVRKFDGYLDVK
VFNSNGKINFNCGADFVKTNQRAPHGIPEDLEPNARCVSVDGDADRVVYYYTDEDGVFHL
LDGDRIATLIAGYLKELVEKCGVELEMGLVQTAYANGASTDYIVNQLKVPVACAPTGVKH
LHHKALDYDVGVYFEANGHGTVIYNAEAKKRIAAASKDESLTQEQRDAAKLLLSTIDLTN
ETVGDAISDMLLVETVLHYRGWSLQDWFAAYADLPNVLMKVKVEDRNVFTTTDDERVCVK
PEGLQDAINEIVAKYPRGRSFVRPSGTEDVVRVYAESETKDGTLQLALEVANVVFDRAGG
VGARPELAKI
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgaccttcaatctgcgccaggtctacgcgttcgcccgcgaatatcaccaaaagcgcgac
tcccagaaggagatccagtacggcacggcaggattccggtcacatgccgacaacctggac
tacgtcatgtaccggatgggcctgctggcggtgctccggtcgcgcgcaaagggtggccag
gttattggcgtgatgataacggcttcgcacaacccggaacaggacaacggcgtcaagctg
gtcgatcccatgggcgaaatgctggagcagagctgggaacggctggccacggatctggtg
aacgtgagcgacgccgacctggagggccaaattgcgaagatcagcaccgagcagggcatc
gacaacaacgaacctgcgaaggtgtacgtgggcatggacacgcgctatcacagtccgcag
ctggcgaaggccgtgctgaacgggattgcggcgctgaagggaagcgtgcgggactttgga
atcgttacgacgccaatgttgcactactttgtgacctgctcgaatacggacttggcgtac
ggactgccgaccgaggagggctacatgacgaagctgttgacggccttcaagcggattcgg
gggaacaccttcgcgaagggaaactacacgaacaaggtgttttacgacggagcgaacgga
gttgggtcgctgaagatgctgggatttgtgcggaagtttgacggatatctggacgtgaag
gtgttcaacagcaatggaaagatcaacttcaactgtggggcggactttgtcaagacgaat
caacgggcgccgcacggaatccctgaagatctggaaccgaacgcacggtgcgtgtcagtt
gatggggacgccgatcgggtcgtgtattattacaccgatgaggacggtgtgttccatctg
ctggacggcgaccggattgccacgttgattgccggctacctcaaagaactcgttgagaag
tgcggggttgagcttgagatgggactggtccagactgcctacgccaacggagcatcaacg
gactacatcgtcaatcagttgaaagtccccgttgcgtgcgccccaaccggagtcaagcat
ctgcaccacaaagcgctcgattacgacgtgggcgtctacttcgaggcaaacggacacggc
accgtaatctacaacgcggaagccaagaagcgaatcgcagccgccagcaaggacgaatcc
cttacccaggagcaacgtgacgctgcgaagctgctgctcagcacgatcgacctgacgaac
gaaaccgttggcgacgccatctccgacatgctgctcgtcgaaacggtcctgcactaccgt
ggctggagcctccaggactggttcgcggcgtacgccgacctgccgaacgtgctgatgaag
gtcaaggtggaagatcggaacgtgttcacgacgaccgacgacgaacgcgtctgcgtcaag
ccggaaggtctgcaggacgccatcaacgaaatcgtggccaagtatccccgcggaaggtcg
ttcgtgcgaccttccggaacggaggacgtggtgcgggtgtacgccgagtccgaaaccaag
gacggcacgctgcagctggcgctcgaagtggccaacgttgtgttcgaccgggctgggggt
gttggcgctcggccggaactggccaagatctaa

DBGET integrated database retrieval system