KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ011260Help
Entry
CpipJ_CPIJ011260  CDS       T01079                                 

Definition
(RefSeq) phosphoglucomutase
  KO
K01836  phosphoacetylglucosamine mutase [EC:5.4.2.3]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu00520  Amino sugar and nucleotide sugar metabolism
cqu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CpipJ_CPIJ011260
Enzymes [BR:cqu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.3  phosphoacetylglucosamine mutase
     CpipJ_CPIJ011260
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_IV PGM_PMM_III PGM_PMM_II
Motif
Other DBs
NCBI-GeneID: 6043962
NCBI-ProteinID: XP_001861542
VectorBase: CPIJ011260
UniProt: B0WVX0
AA seq 550 aa AA seqDB search
MTFNLRQVYAFAREYHQKRDSQKEIQYGTAGFRSHADNLDYVMYRMGLLAVLRSRAKGGQ
VIGVMITASHNPEQDNGVKLVDPMGEMLEQSWERLATDLVNVSDADLEGQIAKISTEQGI
DNNEPAKVYVGMDTRYHSPQLAKAVLNGIAALKGSVRDFGIVTTPMLHYFVTCSNTDLAY
GLPTEEGYMTKLLTAFKRIRGNTFAKGNYTNKVFYDGANGVGSLKMLGFVRKFDGYLDVK
VFNSNGKINFNCGADFVKTNQRAPHGIPEDLEPNARCVSVDGDADRVVYYYTDEDGVFHL
LDGDRIATLIAGYLKELVEKCGVELEMGLVQTAYANGASTDYIVNQLKVPVACAPTGVKH
LHHKALDYDVGVYFEANGHGTVIYNAEAKKRIAAASKDESLTQEQRDAAKLLLSTIDLTN
ETVGDAISDMLLVETVLHYRGWSLQDWFAAYADLPNVLMKVKVEDRNVFTTTDDERVCVK
PEGLQDAINEIVAKYPRGRSFVRPSGTEDVVRVYAESETKDGTLQLALEVANVVFDRAGG
VGARPELAKI
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgaccttcaatctgcgccaggtctacgcgttcgcccgcgaatatcaccaaaagcgcgac
tcccagaaggagatccagtacggcacggcaggattccggtcacatgccgacaacctggac
tacgtcatgtaccggatgggcctgctggcggtgctccggtcgcgcgcaaagggtggccag
gttattggcgtgatgataacggcttcgcacaacccggaacaggacaacggcgtcaagctg
gtcgatcccatgggcgaaatgctggagcagagctgggaacggctggccacggatctggtg
aacgtgagcgacgccgacctggagggccaaattgcgaagatcagcaccgagcagggcatc
gacaacaacgaacctgcgaaggtgtacgtgggcatggacacgcgctatcacagtccgcag
ctggcgaaggccgtgctgaacgggattgcggcgctgaagggaagcgtgcgggactttgga
atcgttacgacgccaatgttgcactactttgtgacctgctcgaatacggacttggcgtac
ggactgccgaccgaggagggctacatgacgaagctgttgacggccttcaagcggattcgg
gggaacaccttcgcgaagggaaactacacgaacaaggtgttttacgacggagcgaacgga
gttgggtcgctgaagatgctgggatttgtgcggaagtttgacggatatctggacgtgaag
gtgttcaacagcaatggaaagatcaacttcaactgtggggcggactttgtcaagacgaat
caacgggcgccgcacggaatccctgaagatctggaaccgaacgcacggtgcgtgtcagtt
gatggggacgccgatcgggtcgtgtattattacaccgatgaggacggtgtgttccatctg
ctggacggcgaccggattgccacgttgattgccggctacctcaaagaactcgttgagaag
tgcggggttgagcttgagatgggactggtccagactgcctacgccaacggagcatcaacg
gactacatcgtcaatcagttgaaagtccccgttgcgtgcgccccaaccggagtcaagcat
ctgcaccacaaagcgctcgattacgacgtgggcgtctacttcgaggcaaacggacacggc
accgtaatctacaacgcggaagccaagaagcgaatcgcagccgccagcaaggacgaatcc
cttacccaggagcaacgtgacgctgcgaagctgctgctcagcacgatcgacctgacgaac
gaaaccgttggcgacgccatctccgacatgctgctcgtcgaaacggtcctgcactaccgt
ggctggagcctccaggactggttcgcggcgtacgccgacctgccgaacgtgctgatgaag
gtcaaggtggaagatcggaacgtgttcacgacgaccgacgacgaacgcgtctgcgtcaag
ccggaaggtctgcaggacgccatcaacgaaatcgtggccaagtatccccgcggaaggtcg
ttcgtgcgaccttccggaacggaggacgtggtgcgggtgtacgccgagtccgaaaccaag
gacggcacgctgcagctggcgctcgaagtggccaacgttgtgttcgaccgggctgggggt
gttggcgctcggccggaactggccaagatctaa

DBGET integrated database retrieval system