KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ011343Help
Entry
CpipJ_CPIJ011343  CDS       T01079                                 

Definition
thrombospondin
Orthology
K04659  
thrombospondin 2/3/4/5
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
Phagosome
ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    CpipJ_CPIJ011343
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    CpipJ_CPIJ011343
Exosome [BR:cqu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CpipJ_CPIJ011343
  Exosomal proteins of colorectal cancer cells
   CpipJ_CPIJ011343
  Exosomal proteins of bladder cancer cells
   CpipJ_CPIJ011343
Heparan sulfate/heparin binding proteins [BR:cqu00536]
 Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
  CpipJ_CPIJ011343
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 817 aa AA seqDB search
MTDEENLAKSLNELIAMVRELREEVKRQREEIQHLRSLIENCAGCQKSPEPLRDSCQQHN
PCFPGVHCYDTQTGVRCGHCPRGYVGDGINCKPGVTCAERPCFSDVACHDTAEGAQCGPC
PERYEGDGKTCHFKNLCNEHLCAAGVQCSMIEQPPYYKCGACPVGFGGNGTVCHDIDECD
LIEPCDVRVRCTNLSPGFRCEPCPPGFTGLHSGGLYAATFDYALQRQRCNDVDECADGSA
RCGPNSICINLEGSYECQCSRGFIRNSTYGCIAVEGMCLDGTICDKNAICKHAGGNTYKC
KCKVGWAGNGFHCGLDRDLDGWADFDLGCTDSRCRQDNCVYVPNSGQEDADKDGVGDACD
PDADNDGVLNSPDNCPLVHNPDQLDTDKEGGDKQGDACDNCPTVANIDQHDVDRDGIGDA
CDPDIDNDGILNERDNCPRKANTNQLDTDGDGIGDVCDNCPAVANVNQMDSDNDLIGDAC
DSDIDRDRDGIQDSQDNCPKLANSDQLDTDGDGRGDLCDPDADNDGILNADDNCPIVPNP
DQTDANNDGVGDICEEDFDLDLIPNYLDNCPNNSKIFSTDFRTYQTVVLDPEGDSQIDPN
WVIYNKGAEIVQTQNSDPGLAVGYDAFGGVDFEGTFFVDTEIDDDYVGFVFSYQDNHKFY
AVMWKKNIQTYWQATPFRASAEPGIQIKLIDSSTGPGQMLRNSLWHTGDTKDQVKLLWKD
PRNVGWKERTAYRWLLLHRPKVGLIRLRIFDGEKMVADSGNIYDSTLKGGRLGVFCFSQE
MIIWSDLVYRCNDNVPEAIYKELPPRLQKDVQVDYKT
NT seq 2454 nt NT seq  +upstreamnt  +downstreamnt
atgacggacgaagaaaatttggccaagtcactcaatgagcttattgcgatggtgcgagag
ctgcgagaagaggttaaaagacaacgagaggaaattcagcatctccgaagtttgattgaa
aactgtgctggttgccaaaagtcgccagaaccacttcgtgacagttgccagcaacacaac
ccttgtttccctggtgtgcactgttatgacacacagactggagttaggtgtggtcattgt
ccacgaggttacgtcggagatggaataaattgcaagcctggagtcacgtgtgccgagaga
ccatgtttttcagacgtagcttgtcacgataccgctgaaggcgcacagtgcggaccatgc
cccgaaagatacgaaggtgatggcaaaacctgccacttcaagaacttgtgcaatgaacat
ctttgtgcagcaggtgtccagtgttcaatgatagaacaacctccatattacaagtgtggt
gcttgtccggttgggttcggtggaaacggaactgtttgtcacgatatagacgagtgtgat
ctcattgaaccctgtgatgtaagggtgcgttgtacaaatctatcgcccggattccgatgt
gagccttgtccaccaggatttactggcctgcatagcggtgggttatatgcggctacattt
gactacgctttgcagcgtcaaaggtgtaacgatgttgacgagtgcgcagatggatccgct
cgatgcggtcctaattcgatctgtatcaacttggagggctcatacgagtgtcagtgtagc
aggggatttatccggaattcaacatacggctgcatagcggtagagggaatgtgcttggat
ggcactatttgtgacaaaaatgcaatttgtaagcatgcaggtggaaatacttacaaatgc
aagtgtaaagtaggatgggctggaaatggtttccactgcggtttagatagagacttagat
ggttgggcagatttcgatttaggctgtacggacagtagatgtcgccaggataactgcgtg
tatgtgccaaactctggacaggaagatgctgacaaagatggtgttggtgacgcctgcgat
ccagatgccgacaacgatggtgtgcttaacagtcctgacaactgccctttggtacacaat
cctgatcaattagacaccgataaggagggtggtgataagcagggagatgcatgtgataac
tgtcccacggtcgcgaatattgatcaacatgacgtcgacagggacggcattggcgatgcc
tgcgatccggatatcgacaatgatggcattttgaatgagagagataattgtccaaggaag
gctaacaccaatcagctcgatactgatggagacggaattggtgatgtctgtgacaactgc
ccagctgttgccaacgtcaaccagatggattccgataatgatttgatcggtgacgcatgc
gatagcgatatcgatagggatcgggacggaatacaagacagccaagacaattgtcctaaa
ctggcaaactccgatcagctggacaccgatggagacggtagaggagacttgtgcgatcct
gacgcggataacgatggaattctgaatgccgatgacaattgcccgatcgtaccaaacccg
gatcaaactgatgccaacaacgatggtgttggagatatttgtgaagaggactttgattta
gatcttattccaaactacttggacaactgtcccaacaattcaaaaatattctcaactgac
ttccggacatatcagactgttgtgttggatcctgaaggagattcacagatcgatccaaat
tgggttatttataacaagggagcagaaatagtacaaacacaaaacagcgatccagggctg
gccgttgggtacgatgcattcggtggagttgatttcgaaggaacattcttcgttgacact
gagattgatgacgactacgttgggttcgtgttcagttaccaggataatcacaaattctac
gctgttatgtggaagaagaacatccagacatactggcaggcaacaccattccgagcttca
gctgaaccgggaattcaaatcaagcttatcgatagtagcacggggccaggccagatgctc
cgtaacagcttatggcataccggggatacgaaggatcaagtcaaactgttatggaaagac
ccaaggaatgtaggatggaaagaacgtactgcgtatcgttggttactcctgcatcgtcct
aaagttggattgataagacttagaatctttgacggtgaaaaaatggtggctgactctgga
aacatttatgattcaacactgaaaggtggccgcctgggcgtattttgtttctctcaagaa
atgatcatatggtctgatttggtttatcgttgtaatgacaatgtaccagaggcaatatac
aaggagttaccacctcgcttgcaaaaagatgtccaggttgactacaaaacttaa

DBGET integrated database retrieval system