KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ011996Help
Entry
CpipJ_CPIJ011996  CDS       T01079                                 

Definition
10-formyltetrahydrofolate dehydrogenase
Orthology
K00289  
formyltetrahydrofolate dehydrogenase [EC:1.5.1.6]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
One carbon pool by folate
Class
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:cqu00670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 935 aa AA seqDB search
MSAASVAAVAAEAKTNGHHNGSDRVEDLKIAIIGQSNFAAEVLEVLLERHHMVVGVFTIA
DKGSREDVLATTARQYGIPVFKVAAWRRKGVPIPEVLEKYQSVGANLNVLPFCSQFIPME
VIDGAKFGSICYHPSILPRHRGASAISWTLIEGDDTAGFSIFWADDGLDTGPILLQKQCP
VVGDDTLDTLYKRFLYPEGVTSMAEAVDAIAEGTAPKIPQTEIGATYDPALFREENQYIN
LNQPALKIFNFIRGLDSVPGALAIIEEEDGSESPVRLHGASLCGPAALENARPVRFKGAA
GPAFVDREGIFITGVDGRLVKVKRLKKGSKMIQASQWFAQVGKKIVPLELNEREQEMEGI
LKNIWKSILKVDIESDTDFFACGAGSMDVVRLVEEVKDALEVPLENEHLFMAPSFVEFLN
EVISRTRNGAGEASVGPAYDGVVLRENKKVISVPTQMFVNGQFIDAENKKTLDIVNPTTE
QVICKVAAASASDVDNAIRCAHEAFKGSWNQVSARERGLLMYKLADLMEQHKEELATIES
IDSGAVYTLALKTHVGMSIDAWRYYAGWADKIEGSTIPVNPAKPNNVLTFTKREPIGVCG
LITPWNYPLMMLSWKMAACIAAGNTVVIKPAQVCPLTALKFAELTVKAGFPAGVINVVTG
SGSITGQAISEHPLVRKLGFTGSTPIGKKIMAACAESNIKKCSMELGGKSPLVIFADCDL
DKAVRLGMSSVFFNKGENCIAAGRLFVEDAIHDEFVRKVVKNIKTMAIGDPLNRGTAHGP
QNHKAHMDKLIEYCEIGVKEGAKLVYGGKRVPNKKGFFFEPTVFTDVEDRMFIAKEESFG
PIMVISKFHSSDFDALVQRANSTEYGLASGVFTKDIRKALLFAEKVEAGTVFVNTYNKTD
VAAPFGGFKQSGFGKDLGKEALNEYLKTKCVTIEY
NT seq 2808 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcggcaagtgtagcagcagtggcagccgaagctaaaaccaatggacatcacaat
ggtagcgatcgcgtagaagacctcaaaatagccatcatcggccagagcaacttcgcggcc
gaggtgctggaagtgctgctcgagcggcaccacatggtggtgggtgtattcacgatcgcc
gataaaggctcccgcgaggacgtgctggccactacggcccgccagtacggcattcctgtg
ttcaaggtcgcggcatggcgccgaaagggcgtcccaattccggaggtgttggagaagtac
cagtcggtgggggcgaacttgaacgtgctgccattctgcagtcagttcatcccgatggag
gtcattgacggggccaagtttggcagcatctgctaccatccgtcgatcctgccgaggcat
cgcggggcgagcgccatttcgtggacgttgatcgagggtgatgacacggccgggttttcg
attttttgggctgacgacgggttggacacgggtccgattctgctgcagaagcagtgtccg
gtggttggggatgacacgctggatacgctgtacaagcgatttttgtacccggaaggagtg
acttcgatggctgaggctgtggacgcgatcgccgagggaactgctccaaagattccgcag
acggagattggagcgacgtacgatccggcgctgttccgcgaggagaaccaatacatcaac
ttgaaccagccggcgctgaagattttcaactttatccgggggttggactccgtcccggga
gcgctagcgatcatcgaagaagaagatggatcggagagtccggtgcggctgcacggtgct
tcactgtgtggtccggcagcgctggagaatgccaggccggttcgcttcaagggagcggcg
ggcccagcgtttgtcgatcgggaaggtatctttatcactggagtcgatggacggttggtt
aaggtgaagcgactcaagaaaggcagcaagatgattcaggcgagtcagtggtttgcgcag
gttgggaagaagatcgttccgttggaattgaatgagcgggagcaggagatggaggggata
ttgaagaacatctggaagtcgatcctgaaagtggacattgagtcagatacggatttcttc
gcgtgtggagctggatcaatggatgtggttcgattggtcgaggaagtgaaagatgctttg
gaggtaccgttggaaaacgaacacctgttcatggctcctagctttgtagagtttctaaat
gaagtaatcagtaggactcgaaacggtgctggagaagcgagtgttggtccagcttacgac
ggcgttgttctacgcgaaaacaagaaggtgatctccgttccaacgcagatgtttgtcaac
ggacagtttatcgatgcagagaacaagaaaacgttggacattgtgaatccgacgactgaa
caagtaatctgcaaggtagcagctgcatccgcatcggatgtagataacgcgatcaggtgt
gctcacgaagcgttcaaaggtagctggaaccaagtgtccgcacgggagcgaggtctgttg
atgtacaagctggcggatctaatggaacagcacaaggaagaacttgccacgatcgagtct
attgattctggagcagtgtacacgctggcgctgaagacgcacgtcggcatgtcgatcgat
gcgtggaggtattacgccggatgggctgacaagatcgaaggttcaacgattccggtgaat
ccggcgaaaccgaacaacgtactaacgtttacgaagcgggaaccgatcggggtttgtgga
ctgatcaccccctggaactacccgctgatgatgttgtcctggaagatggcagcctgcatc
gcggctggcaataccgtggtcattaaacctgcccaagtatgtccgctgacggcgttgaag
ttcgctgaactaacggtgaaggcaggattcccagcgggggtaattaacgtagtcacggga
agcggatcgatcacggggcaagcgatatccgaacatccgctggtacggaagctcggcttc
actggatctaccccgatcgggaagaagatcatggcggcatgcgcagagtcaaacatcaaa
aagtgctcgatggagctgggtggaaagagcccgctggttatctttgccgattgtgacctg
gacaaggcggttcggttgggaatgtcttcggtgttcttcaacaagggtgaaaattgtatt
gccgctggtcggctgtttgtggaggacgccattcacgacgagtttgtgcggaaggtggtg
aagaacatcaagactatggcaattggagatccgttgaaccgaggtactgcacatggtcca
cagaaccacaaggctcacatggacaagctgatcgagtactgtgagatcggagtcaaggaa
ggagccaagctggtgtacggaggcaagcgagttccgaacaagaagggattcttcttcgaa
ccaacggtgtttacggatgttgaagatcgcatgttcatcgccaaggaggagtcgttcgga
ccgatcatggtgatctccaagttccacagcagtgactttgacgcgttggttcagcgggcg
aatagcaccgagtacggactggccagtggagtgtttaccaaggacatccggaaggcgttg
ctgttcgcggagaaggtggaagccggaacggtgtttgtcaatacttacaacaaaacagac
gtggctgcgccgtttggcgggttcaagcagagtgggttcgggaaggatcttggaaaggaa
gctctcaacgaatacctcaagacaaagtgcgttactattgaatactag

DBGET integrated database retrieval system