KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ012030Help
Entry
CpipJ_CPIJ012030  CDS       T01079                                 

Definition
(RefSeq) 3-hydroxyisobutyryl-coenzyme A hydrolase
  KO
K05605  3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu00280  Valine, leucine and isoleucine degradation
cqu00410  beta-Alanine metabolism
cqu00640  Propanoate metabolism
cqu01100  Metabolic pathways
cqu01200  Carbon metabolism
Module
cqu_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    CpipJ_CPIJ012030
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CpipJ_CPIJ012030
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CpipJ_CPIJ012030
Enzymes [BR:cqu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     CpipJ_CPIJ012030
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ECH_2 ECH_1
Motif
Other DBs
NCBI-GeneID: 6044852
NCBI-ProteinID: XP_001862297
VectorBase: CPIJ012030
UniProt: B0WY25
AA seq 355 aa AA seqDB search
MLTRNLPRTVPSALFRAMSSSADRTVLCEEFGPDKGVITLNRLKALNAINLDMVRQIYGA
MRSWQGQKNLVIVKGAGEKSFCAGGDVRSLVEAGPVPESRNFFREEYNLNALIGSYKPDY
VAMIDGITMKGRGWVVPPVRVPRQRCSDARDRDRLFQDVGGGLTGFRLKGKDVAKAGIAT
HYVESKNLEALEKELLASKNSSDVAATLDKFNVQDSSEFVLAKNLKQINACFSGPTVESI
LAALEADGSEWAQSTLKTLAKMSPLSMKVTKKQLDLGRTMDLRSCLRMEFRMAVHCLIDS
DFKEGVRALLIDRDQSPKWKPTTLGEVTEQQVDRFFGALPDGDELLFEDEVKANM
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgttaacccgaaacctgccgcgaaccgttccgtcggccctgttccgagccatgtcttct
tccgcggatcgcaccgtcctctgcgaggagtttggcccggacaagggcgtcatcacgctg
aaccgcctcaaggcgctgaacgccatcaacctggacatggtgcggcaaatctacggcgcg
atgcggtcctggcagggccagaagaacctggtcatcgtgaagggcgccggggagaagtcg
ttctgcgccggtggggacgtccgctcgctcgtggaagccggccccgttccggagtcgagg
aacttcttccgcgaggagtacaatttgaacgcgctgatcgggtcctacaagccggattac
gtggccatgatcgacgggatcacgatgaaggggcggggttgggttgtcccgccagtacgc
gtgccacgccaacgatgttcggatgcccgagaccgcgatcgactgtttcaggacgtcggc
ggcggcctgacgggattccgccttaaaggcaaggacgtggccaaggctggcatcgcgacg
cactacgtcgagagcaagaatctggaagcgctcgagaaggaactgctcgcgagtaaaaac
agctcggacgttgccgcaaccctggacaaattcaacgtccaagatagttccgagtttgtg
ctggcgaaaaacctcaaacaaatcaacgcgtgcttcagcggtcccacggtggaatcgatc
ctggcggcgctcgaagcggacggcagcgagtgggctcagtcgacgctgaaaaccctcgcc
aaaatgtccccgctgtcgatgaaggtcaccaagaagcaactcgacctgggtcgcaccatg
gacctgcgaagctgtctgaggatggagttccggatggccgtccactgcctcatcgatagt
gacttcaaggagggcgtgcgagcgctgttgattgaccgtgatcagagtcccaagtggaag
ccgaccacgctgggcgaggtgacggagcagcaggttgatcggttctttggcgcgctgccc
gacggcgacgagctgctgtttgaggatgaggtgaaggctaatatgtaa

DBGET integrated database retrieval system