KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ012031Help
Entry
CpipJ_CPIJ012031  CDS       T01079                                 

Definition
eukaryotic translation initiation factor 4e type
Orthology
K03259  
translation initiation factor 4E
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
RNA transport
mTOR signaling pathway
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    CpipJ_CPIJ012031
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    CpipJ_CPIJ012031
Translation factors [BR:cqu03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    CpipJ_CPIJ012031
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 164 aa AA seqDB search
MLLTTSNIPLELTRRNPAKAKSAISAKASQPLASTKAEFGAANSAGNVDPRMRTPTKSGI
KPMWEDPGNVRGGKWVIRLKKNKIDRAWENVCMAMLGEQFLVGPEICGVVLSTQFPEDLL
SIWNRTATDTTSTNRIRDTLRRILNLPPSTHMEYKPHCDSLKYL
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgctgttgacgacttccaacatcccactcgaactcacccgtcgaaatccggccaaggct
aaatcggccatctcggccaaagcgtcccagccactggcgtcgaccaaggcagagttcggt
gccgccaacagcgccgggaatgtggaccccagaatgagaaccccgacgaagagtggcata
aagcccatgtgggaggaccccggcaatgtgcgcggcggcaagtgggtcatccggttgaaa
aaaaacaaaatcgaccgcgcgtgggagaacgtctgcatggcgatgctgggcgagcagttc
ctggtggggccggaaatctgcggcgtcgtcctgtccacgcagttccccgaggatctgctg
tccatctggaaccggacggcgacggacacgaccagcacgaaccgcatccgggacacgtta
cgaagaatcctgaacctacctccgtcgacgcacatggaatacaaaccgcactgcgatagt
cttaagtacctctga

DBGET integrated database retrieval system