KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ012311Help
Entry
CpipJ_CPIJ012311  CDS       T01079                                 

Definition
histone deacetylase
Orthology
K11407  
histone deacetylase 6/10 [EC:3.5.1.98]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Brite
Enzymes [BR:cqu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     CpipJ_CPIJ012311
Protein phosphatases and associated proteins [BR:cqu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CpipJ_CPIJ012311
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 1108 aa AA seqDB search
MYKFKKIYAVSSTVVTRQGAQKTKITTRAQRASVEAAETERKAKFYGTRKPNPALAEAKK
RGKLKMSTEPKEGAANPDQNGGVVQLKDIYGSAIAATELVRGPTGLVYDEKFAEHRCLWD
DGYPECPERFTRVLERCRELKLVERCAVIEPRMASEEEVLTKHTPEQLEILKSTRGSQDV
AALEELSSHYDAVFIHPSSYDCSLLSAGSTIELVDAILEGRVQNGMAIIRPPGHHAMKAE
YNGYCFFNNVAIAAQHALDKRGLKRILVVDWDIHHGQGTQRMFYDDPRVLYFSIHRYECG
TFWPNLRESDFDCIGEGAGLGYNFNVPLNRIGMTNGDYLAIWQQLLLPVALEGQMEITPA
FYPHLLSPLMSLAQGKVAVVLEGGYCLTSLAEGGALTLRALLGDPCPLLVEKLQPPCESM
QQTILNCVHSHRPYWKNLQLNATYGLEELNNVNPQPNFHQVIQYYVQQEPKPEPVRYETR
NCYPVQASEEKNRIEERLAMLQIATRLTFPATRVCYVYDDLLLEHRNLHEDLHPEQPQRI
ARIFSRHEEYKLLPRMKRLKPRHATTDELCLVHSRQHVNVIRRTVEREEMKQVADKFNSV
YFHPKTFECATLATGSVLQVVDEVLNGQSRSGVCIVRPPGHHAESDMPHGFCIFNNVAIA
AQYAIRDHGLKRVLIVDWDVHHGNGTQHIFESNPKVLYMSVHRYDNATFFPKSKDANYDS
VGNGTGEGFNVNIPWNKKGMGDQEYAAAFQQVILPIAYEFDPELVLVSAGFDAAIGDPLG
GCKVTPEAYGHFTHWLSSLANGRVIVCLEGGYNVNSISYAMTLCTKSLLGDPLPMLHVSQ
RYNGPNAACVESIRNVLSVQEKFWKSLKFNKKLPDFRSATGEADLNSAFGKLQLSAGTSG
SSTDSSPAKNSSDDSGVPFDGDDQPGPSRRRNKQTTDGQQSASGSSGAGEGSSNSGTKQE
TLQDFLAANLEALQNEEMFAVIPLRDCPHLKELNPDNIPDKISTNAPCTGCESSVENWVC
LLCFNVCCGRYINEHAIEHATVTEHPLALSFSDLSVWCYKCESYVDNPVLYPYKNLVHQD
KFGGEQLVWSYGSDLVLDVKPPTTKTKE
NT seq 3327 nt NT seq  +upstreamnt  +downstreamnt
atgtataaattcaagaagatttatgctgtgagttccaccgtcgtgactcgacagggcgcc
caaaagaccaaaatcacaacccgagcccagcgtgcgtcggtcgaagcggcggaaaccgaa
cgaaaggccaaattctacggaaccagaaagcccaacccagcgctcgcggaagcgaaaaag
cgaggcaagctgaaaatgtccacggaaccgaaggaaggggcggccaatccggaccagaac
ggtggcgttgtccagctgaaggacatttacggcagcgcgatcgccgcgacggaactggtc
cgcgggccgaccgggctggtctacgacgagaagtttgccgagcatcggtgcctgtgggac
gacggatatccggagtgtccggagcggttcacccgggtgctggaacggtgccgggaactc
aagctggtcgagcgatgtgccgtgattgaacctcggatggccagcgaggaggaggtgttg
acgaagcatacgcccgagcagttggagattctcaagagtacacggggctcgcaggatgtg
gccgcactggaggaactaagttcgcattacgacgcggtctttatccatccgtcatcctac
gattgttcgctactatcagcgggtagtacgatcgagctggtcgatgcaattttggagggg
cgtgtgcagaacggaatggccatcatccggccgccgggtcaccacgccatgaaggccgag
tacaatgggtactgcttcttcaacaacgtggcaattgcggcgcagcatgcgctcgataag
cgtggactgaagcggatcctggttgtcgactgggacatccaccacggacagggaacgcag
cggatgttttacgatgatccgagagtcctgtatttttcgatccatcgctacgagtgcgga
acgttctggccaaacctgcgcgagtccgactttgactgcatcggcgaaggcgctggactg
ggctacaactttaacgtcccgctcaaccgaatcggaatgaccaacggagactatctggcc
atttggcagcaactattgctaccggtggcactggagggccaaatggagattacgccggcg
ttttaccctcacctcctttcaccactgatgtccctagcgcaaggcaaggtcgccgtagtc
ctggaaggtggctattgcttgacgtctctcgccgaaggaggcgcgttaacgttgcgtgcc
ctgctgggagatccgtgtccgctgctggtcgagaagcttcagccgccgtgcgaaagcatg
cagcagactattctgaactgcgtccattcgcatcgaccgtactggaagaatttgcagctg
aacgcgacgtacggattggaagagttgaacaacgttaatccgcagccaaactttcaccaa
gttattcagtattacgtccagcaggagccaaagccggaaccggttcgatatgaaacgaga
aattgttatcccgtccaggctagtgaagagaagaatcggatcgaggagaggctagctatg
ctgcagattgcaaccaggttgaccttcccggcgacccgggtttgctacgtgtacgacgat
ctgctgctcgagcatcgcaatctgcacgaggatcttcatccggagcaaccgcaacgaata
gccagaatcttttcgcgccacgaagagtacaaactgttaccacgaatgaagcgacttaag
ccacgtcacgcgaccactgacgaactgtgtctggtgcactcgcgccagcacgtgaacgtg
attcggaggacggtcgagcgggaagagatgaagcaagtggcggacaagttcaactccgtg
tacttccatccgaagacgttcgagtgcgccacgctggcgaccggatcggtgctacaggtc
gttgacgaagtgctgaacgggcagtcccgtagcggtgtgtgcattgtacgaccgccgggg
caccacgccgagtcggatatgccgcacggattttgcatctttaacaacgtggccattgcg
gcgcagtacgcaatccgcgatcacgggctgaagcgagtgttgatcgttgattgggacgtg
caccacggtaacggaacgcaacacatctttgagagcaacccgaaggtcctttacatgtca
gtccatcggtacgacaacgcgaccttcttcccaaagagcaaggatgcgaattacgactcc
gtgggaaatggcaccggtgaaggcttcaacgttaacattccatggaacaagaagggcatg
ggagatcaagaatatgccgcagccttccaacaagtcatcctaccgatcgcgtacgagttc
gatccggaactggtcctagtttcagctggttttgatgccgccattggtgatccactcggc
ggttgcaaggtcacgccggaagcatacggacacttcacccactggctttcctcgctggcc
aacggtcgtgtgatcgtgtgcctcgagggaggttacaacgtaaactcaatctcctacgcg
atgaccctctgtacaaagtccctcctgggtgatccactcccgatgctacacgtcagtcaa
cgctacaatggaccaaacgctgcctgcgtcgaatcgatccgaaatgtgctgtcggtgcag
gaaaaattctggaagtcgctcaaattcaacaaaaaactacccgactttcgcagtgccaca
ggcgaagccgacctgaacagcgccttcggtaagctgcaactttctgcgggaacctctgga
tcttcgacggactcgtccccagcgaagaactcgagcgacgattcgggcgttccgttcgat
ggtgacgatcaacccggaccaagccgaagacggaacaagcaaaccactgacggtcaacag
agcgcatccggtagcagtggagccggtgaaggatcttccaactcgggaacgaagcaagaa
acgttgcaggatttcctagctgcaaacttagaggccttacaaaacgaggaaatgtttgcc
gtcatcccgttacgagactgcccccaccttaaggaactcaaccccgacaacatccccgat
aaaattagtacaaacgctccgtgcaccggctgcgagtcctccgtggaaaactgggtctgc
ctgctgtgcttcaacgtgtgctgcggtcgctacatcaacgaacacgcaatcgaacatgcc
acggtcacggaacatccgctcgcgctaagcttcagcgatctgtccgtgtggtgttacaag
tgcgagtcctacgtcgacaacccggtcctgtacccgtacaagaatctcgtgcaccaggac
aagtttggcggcgaacagctagtttggtcgtacgggagtgatctcgtcctcgatgtgaaa
ccgccaacgaccaaaacgaaagaatga

DBGET integrated database retrieval system