KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ012413Help
Entry
CpipJ_CPIJ012413  CDS       T01079                                 

Definition
histone H2B.1/H2B.2
Orthology
K11252  
histone H2B
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 124 aa AA seqDB search
MAPKTSGKAAKKSGKAQKNITKGDKKKKKVRRKESYAIYIYKVLKQVHPDTGISSKAMSI
MNSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKY
TSSK
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atggcaccaaaaaccagcggtaaggccgccaagaagtccggcaaggcccagaagaacatc
accaagggtgataagaagaagaagaaggtccgcaggaaggagagctacgccatctacatc
tacaaggtgttgaagcaggtccaccctgacaccggtatctcgtccaaggccatgagcatc
atgaacagctttgtcaacgacatcttcgagcgtatcgccgccgaagcgtcccgtctggct
cactacaacaagcgctcgaccatcacgtcccgcgaaatccagaccgctgttcgtctgctg
ctgcctggtgagctggccaagcacgccgtctctgagggtaccaaggctgtcaccaagtac
accagctccaagtaa

DBGET integrated database retrieval system