KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ012757Help
Entry
CpipJ_CPIJ012757  CDS       T01079                                 

Definition
neuroendocrine convertase
Orthology
K01360  
proprotein convertase subtilisin/kexin type 2 [EC:3.4.21.94]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Brite
Enzymes [BR:cqu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.94  proprotein convertase 2
     CpipJ_CPIJ012757
Peptidases [BR:cqu01002]
 Serine Peptidases
  Family S8: subtilisin family
   CpipJ_CPIJ012757
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 525 aa AA seqDB search
MRSAIPAATPDKSDPNVGKAPTDPYFPLQWYLRNTGQNGGKPRLDLNVQAAWDQGITGKN
VTTAIMDDGVDYMHPDLKFNYNAEASYDFSSNDAYPYPRYTDDWFNSHGTRCAGEVAAAR
DNGICGVGVAYDSKIAGIRMLDQPYMTDLIEANSMGHEPHKIHIYSASWGPTDDGKTVDG
PRNATMRAIVQGVNEGRNGLGNIYVWASGDGGEEDDCNCDGYAASMWTISINSAINDGQN
AHYDESCSSTLASTFSNGAKDPNTGVATTDLYGKCTTTHSGTSAAAPEAAGVFALALEAN
PSLTWRDIQHLTVLTSKRNSLFDAKNRFHWTMNGVGLEFNHLFGFGVLDAGAMVSLAKKW
RTVPPRYHCEAGAILEAHQIPSKGSLLLSIKTDACKGTDTELRYLEHVQAVITANASRRG
DLELFVTSPMGTKSMILSRRANDDDHRDGFTKWPFMTTHTWGEYPEGTWLLEATFNSKEP
RTGWLKEFSLVLHGTKDPPYRMLSPASPHSKLAIVKKAHEDQDKM
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgcgttccgccattccggctgccactcccgataagtcggatcctaacgtcggcaaagct
cccacagatccttatttcccgctgcagtggtaccttaggaatacgggacagaatggtgga
aagccgcggttggatttgaatgtgcaagccgcgtgggatcagggtattaccgggaaaaac
gtaactacggccatcatggacgacggcgttgactacatgcacccggatcttaaattcaat
tataacgcggaagctagctatgactttagcagtaatgatgcgtatccatacccacgttac
acagatgactggttcaatagccacggtactcgatgcgctggagaagtagcggcggctcgt
gataatggcatttgtggtgttggcgtcgcttatgattcaaagattgccggaatcaggatg
ctggatcaaccctacatgacggatcttatcgaggcaaactcgatgggccacgaaccccat
aaaatccacatatacagtgcttcgtggggtccaacagacgacggcaagacggttgatggg
ccacgtaacgcgaccatgcgagccatagttcaaggagtgaacgaagggcgcaacggtttg
ggcaacatttacgtttgggcgtcgggtgatggcggagaggaggacgattgtaactgcgat
ggctatgctgcttccatgtggacgatttcgatcaacagtgcgatcaacgacggtcaaaac
gcccattacgacgagagctgtagttctacattggccagtacgtttagtaacggagcaaag
gatccaaacactggagtggccacgaccgacctgtatggaaagtgcacaactactcattcc
gggacgagtgctgctgcaccggaagctgcaggagtatttgctcttgcattggaagctaac
ccctcccttacatggcgagacattcaacacctcacggtgctgacgtccaagaggaattcc
ttgtttgacgcgaaaaatcgattccactggacaatgaacggcgttggacttgagtttaac
catttgttcggcttcggagtcctcgacgcgggtgccatggtatctctggccaagaagtgg
cgtacggttcctccacgttatcattgcgaagccggggcgattttggaagcacaccaaatt
ccatcaaaggggtcacttttgctgagcatcaaaactgatgcatgcaaagggactgatacc
gagcttcggtatctggaacatgtgcaagcggttataacagctaatgcaagtagacgcggt
gatttggagttgtttgtcacttctccgatgggaactaagtccatgatactaagtcgtcgt
gccaacgatgacgatcatagagatggatttacaaagtggccgtttatgaccacacacaca
tggggcgaatacccggagggtacttggttacttgaggctacattcaattcaaaggaaccg
cgaacgggatggttgaaagaattctcactagtgctgcacggaaccaaagacccaccatac
cggatgctctcaccagcttctcctcactcgaaactggcgatcgtcaagaaagctcacgaa
gatcaagataaaatgtaa

DBGET integrated database retrieval system