KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ012855Help
Entry
CpipJ_CPIJ012855  CDS       T01079                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CpipJ_CPIJ012855
Enzymes [BR:cqu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     CpipJ_CPIJ012855
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 320 aa AA seqDB search
MSQNLDVVVFGSCIVDFISYVPRLPRVGETLHGTKFVTGFGGKGANQCVAAARLGSRTAI
IGKLGNDPWGSNYRKALESEGVNVDHVKIVKGESTGIAQINVADNGDNQIVIVVGANNSL
LPADVGVSADLLTRAKILVCQLETPLAGTLEALRTFSGTSIMNAAPAVENVPHDLLRLCS
IFCVNETEAALITGVPVATVIQAKGALLKLRDMGCNTVVITLGDKGAIFASKDNAKVVHV
KPCKVDKVVDTTGAGDAFIGALAHFMARNPEAELTQCIAAANKVASLSVQKPGTQTSFPR
LSETGLGQDLSSNPCEWEYI
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcagaatctggatgtggtcgttttcgggtcgtgtattgtcgatttcattagctat
gttccgcgacttccgcgggtgggcgaaacgctgcacgggacgaaattcgtcaccgggttc
ggaggtaagggcgccaatcagtgcgtggcggcggctcggctagggtcgcgtacagccatc
atcgggaagctgggcaatgacccgtggggtagcaattaccgaaaggcgctcgagtccgag
ggcgtaaacgtcgaccacgtgaagatcgtgaagggcgaaagtacgggaatcgcccaaatt
aatgtggctgataatggggacaaccagattgtgatcgtagtaggcgccaacaacagccta
ctgccggcggatgtgggtgtgagtgctgacctgttgacgcgggcgaagatcctggtttgt
cagctggagacgcctttggcggggacgttggaggcgttacggaccttctccggaacttcg
atcatgaacgcggcgcccgccgtggaaaacgtcccgcacgacctgctccgcctctgttcg
atattctgcgtcaacgagacggaagcggcgctcatcaccggagtgcccgtagcgacagtc
attcaagccaaaggcgccctgctgaagctacgcgacatgggctgcaataccgttgtgatc
acgctgggcgacaaaggcgccatctttgcgtccaaagacaacgccaaagtggtgcacgtg
aagccgtgcaaggtggacaaagtcgtcgacacgacgggtgctggtgatgcctttataggc
gcgttggcgcactttatggcgcggaatccggaagctgagctaacgcagtgcattgcggcc
gcaaacaaagtggcgtcgctgtcggtgcagaaacccggaactcagaccagctttccgcgg
ctttcggagacgggacttggccaggacttgtcatcgaacccgtgcgagtgggagtacatt
tga

DBGET integrated database retrieval system