KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ013529Help
Entry
CpipJ_CPIJ013529  CDS       T01079                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cqu00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:cqu00670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 184 aa AA seqDB search
MKKLSLIAAVCQNGGIGIKGDLPWHLKAELKYFSRMTKKVNDSAKRNAIIMGRKTYFGVP
EAKRPLSERLNIVLTRDPTANVYPAGVMVCTSMQEALDRLDQSPLVDEIETIWIVGGNAV
YKEAMESDRCHRLYITDVKGTFNCDAFFPEITSDFKLVKNDADVPEEIQEENGIQYQYKI
YEKC
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaactttctttgattgctgctgtctgccaaaatggtggaattggtataaaaggg
gatttaccttggcatttgaaggctgaactgaaatatttttcgcggatgaccaagaaagta
aacgacagtgctaagcgaaatgccattatcatgggcagaaaaacttatttcggagttccg
gaggctaagcgccccctgtcggagagattaaacatcgttctgacacgtgatcctactgcg
aatgtgtacccagcaggagtcatggtttgtactagcatgcaagaagctttggatcgactg
gaccagagtcctttggtggatgaaattgaaacgatttggattgtgggtggaaatgcagtt
tacaaagaggcgatggagtcggatcgctgccatcgtttatacatcacagatgttaaggga
acatttaactgtgatgcgttttttccagagataacttcagattttaagctggttaagaac
gatgcagatgttccggaagagattcaggaggagaacggaattcaatatcaatataaaatt
tacgaaaagtgctaa

DBGET integrated database retrieval system