KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ013749Help
Entry
CpipJ_CPIJ013749  CDS       T01079                                 

Definition
delta(9)-desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:cqu01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:cqu01040]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 388 aa AA seqDB search
MAPGRDISPGASVQGKDKSSTKEIITDTNNNAVSMGDDKSISDRELDAYMERYNRWQQSA
AGKWAQDKLADWTGLKFDNEIKWKNVFLLGTLHLVTAALFFVYVWEATPVTYLWCFFVGG
CAGFGVTAGAHRLWTHRAYKANLPLRVILMCCFCMSGQNTLYDWIRDHRIHHKYSETDAD
PHNSNRGFFFAHVGWLLLRKHPECIKKGRLIDMSDIMADPVVRFQEKYFPLLKTLFTYVI
PSVIPWYFFGQDFMLSFLSNCLLRNVLTLNFTWLVNSAAHMYGSKPYDNRIQPVENKWVS
MVAMGEGWHNYHHVFPWDYKAAELGDYKVNVSTFWIDLFAKIGWAWDLKEPSKELVKRTI
AKYGDGTHINGKIEHLAEVPYPETQKTQ
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atggccccgggacgggacatctccccgggagcctcggtccagggcaaggacaaaagctcc
accaaggagatcattaccgataccaacaacaatgccgtctcgatgggcgacgacaagtcc
atcagcgaccgcgagctggacgcgtacatggagcggtacaaccggtggcaacagtccgcg
gccggaaagtgggcccaggacaagctggccgattggaccgggctaaagttcgacaatgaa
atcaagtggaagaatgtgttccttctcggaacgttgcacctggtgacagcggcgttgttt
ttcgtgtacgtctgggaagccacgccggttacctatctttggtgttttttcgtcggaggc
tgtgccggtttcggggtgaccgccggtgcccaccggctgtggactcaccgggcttacaag
gcaaatctacccctgcgcgttatcctcatgtgctgcttctgcatgtccggtcagaacacc
ttgtacgactggatccgtgaccatcgcatccaccacaagtactccgaaacggacgccgac
ccgcacaactcgaaccggggcttcttcttcgcccacgtcggttggctgttgctgaggaag
catccggagtgcatcaagaagggtcggttgatcgacatgtcggacattatggccgaccct
gtcgtccgattccaggagaagtacttccccctgctgaagacgctcttcacctacgtcatt
ccctcggttatcccgtggtacttcttcggccaggacttcatgctgtccttcctgtccaac
tgtctgctccgaaacgtgctgacccttaacttcacctggttggtcaacagtgccgcccac
atgtacggcagcaaaccgtacgacaatcgcatccaacccgtcgagaacaagtgggtatcg
atggtagccatgggtgagggctggcacaactatcaccacgtgttcccgtgggactacaaa
gcggctgagctgggagactacaaggtcaacgtttccaccttctggatcgacctgtttgcc
aaaattggctgggcgtgggatctcaaggaaccctccaaggaactggtgaaacgaacgatc
gctaaatacggtgatggaactcacatcaacggcaagatcgaacaccttgcggaggttccc
tatccggaaacgcaaaagacgcagtaa

DBGET integrated database retrieval system