KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ013749Help
Entry
CpipJ_CPIJ013749  CDS       T01079                                 

Definition
delta(9)-desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    CpipJ_CPIJ013749
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    CpipJ_CPIJ013749
Enzymes [BR:cqu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     CpipJ_CPIJ013749
Lipid biosynthesis proteins [BR:cqu01004]
 Desaturase
  First
   CpipJ_CPIJ013749
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 388 aa AA seqDB search
MAPGRDISPGASVQGKDKSSTKEIITDTNNNAVSMGDDKSISDRELDAYMERYNRWQQSA
AGKWAQDKLADWTGLKFDNEIKWKNVFLLGTLHLVTAALFFVYVWEATPVTYLWCFFVGG
CAGFGVTAGAHRLWTHRAYKANLPLRVILMCCFCMSGQNTLYDWIRDHRIHHKYSETDAD
PHNSNRGFFFAHVGWLLLRKHPECIKKGRLIDMSDIMADPVVRFQEKYFPLLKTLFTYVI
PSVIPWYFFGQDFMLSFLSNCLLRNVLTLNFTWLVNSAAHMYGSKPYDNRIQPVENKWVS
MVAMGEGWHNYHHVFPWDYKAAELGDYKVNVSTFWIDLFAKIGWAWDLKEPSKELVKRTI
AKYGDGTHINGKIEHLAEVPYPETQKTQ
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atggccccgggacgggacatctccccgggagcctcggtccagggcaaggacaaaagctcc
accaaggagatcattaccgataccaacaacaatgccgtctcgatgggcgacgacaagtcc
atcagcgaccgcgagctggacgcgtacatggagcggtacaaccggtggcaacagtccgcg
gccggaaagtgggcccaggacaagctggccgattggaccgggctaaagttcgacaatgaa
atcaagtggaagaatgtgttccttctcggaacgttgcacctggtgacagcggcgttgttt
ttcgtgtacgtctgggaagccacgccggttacctatctttggtgttttttcgtcggaggc
tgtgccggtttcggggtgaccgccggtgcccaccggctgtggactcaccgggcttacaag
gcaaatctacccctgcgcgttatcctcatgtgctgcttctgcatgtccggtcagaacacc
ttgtacgactggatccgtgaccatcgcatccaccacaagtactccgaaacggacgccgac
ccgcacaactcgaaccggggcttcttcttcgcccacgtcggttggctgttgctgaggaag
catccggagtgcatcaagaagggtcggttgatcgacatgtcggacattatggccgaccct
gtcgtccgattccaggagaagtacttccccctgctgaagacgctcttcacctacgtcatt
ccctcggttatcccgtggtacttcttcggccaggacttcatgctgtccttcctgtccaac
tgtctgctccgaaacgtgctgacccttaacttcacctggttggtcaacagtgccgcccac
atgtacggcagcaaaccgtacgacaatcgcatccaacccgtcgagaacaagtgggtatcg
atggtagccatgggtgagggctggcacaactatcaccacgtgttcccgtgggactacaaa
gcggctgagctgggagactacaaggtcaacgtttccaccttctggatcgacctgtttgcc
aaaattggctgggcgtgggatctcaaggaaccctccaaggaactggtgaaacgaacgatc
gctaaatacggtgatggaactcacatcaacggcaagatcgaacaccttgcggaggttccc
tatccggaaacgcaaaagacgcagtaa

DBGET integrated database retrieval system