KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ013972Help
Entry
CpipJ_CPIJ013972  CDS       T01079                                 

Definition
trithorax
Orthology
K09186  
histone-lysine N-methyltransferase MLL1 [EC:2.1.1.43]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    CpipJ_CPIJ013972
Enzymes [BR:cqu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     CpipJ_CPIJ013972
Transcription factors [BR:cqu03000]
 Eukaryotic Type
  Zinc finger
   Cys4 Trithorax
    CpipJ_CPIJ013972
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 3165 aa AA seqDB search
MAVLGDIGLRNAPSDPSDGPSEPTPARPASSISINNPFAKTSLLDAVSGTSASCTSSSGT
TLKLMKPAVLLSAATASTSSSLASATSIFGKSILRQPRLQFTTSLLNSNPLASDGGSGGA
APERTTVSDGPFSLHLKAGTELDSSKIFSSALTASGGASEGTPSGASGAVGPSCSICGIA
DSGRHHQAGTEKHGIGCHTCRKFISMIKKRTKGPNPCGVLKCKNDSKCSVKTMVRPSHVR
SNHIFKERCHVCWVRRCLTGFPLPPSLKTTLTQILPPMSRQVDSTAPASSTSVKKESSIE
NNIFSNSLSSGLPTVAAPRILWNTSTEKSEFPKTSSFPSLSNPLAQNNSTFGSLPPIKLN
ISDKPLILAPSSLGSPKIAKEEIPVAPTVEKNLEEPEPVASTTNPDVTTKVLRPRNKAEP
ATPTPTSTNTASVSSPPPVVTTTSTVVSPTATTTTSTAAVTADAARQRIDLKGPRVKHVC
RSASIVLGQPLAMFPDDEAAAVDATLENIETPPSDSAAEGADDVPAVSQLPLPLEPTKPS
EELQSPCADCKEEPPNLTLSPPATPVADADTSGSTEKDLVIDEDRVSESSTPTKEVEPPK
PETEPPVEVIPVATPAPVVVKLELDVKEKIEVARKIEEIERPTTRKATSAIRPQVLKQNI
NAITKSFNTNVRATAIGQQTVPEVPNAPLISIDFWENYDPAEVSRTGFGLILSEEVPLKA
LCFLCGSSGLDEMLFCVCCCEPYHQYCVKDEYNIRHASLDETNISLLELTSTTIVNSSPA
QQALNRFNWMCPRCTVCYTCNMATGTKVKCQKCCKNYHTTCLGTSKRLLGADRPMICAAC
LKCKSCSTTNVTKFIGNLPMCTPCFRLRQKGNFCPLCQRCYEENDFDLKMMECGDCQRWV
HAKCEGLTDEQYNMLSALPENIEFICKKCGKNNESANVWRDAVAAEFKAGLLSVVKLLSK
SRQACALLKLSPRKKTSNCTCLVSSGKSISFFSFGTSKEESSVASKKPKLDEDSIYDFNS
ESSSSSTSFPPATKCYCSLKPVKPSDISLVEIKQKINANEYYSLQDFNYDMNTLINSIGS
EELSTAYKEFLSETFPWFQNETKACTDALEEAMCGEEMMGGDYGLVPTGDVHLEQDQKVP
SIDIPLDEIDDYFYESSDVKDTRICMLCKQPGEGLPLHESRLLYCGQNNWTHTNCALWSA
EVFEEIDGSLQNVHSAASRGRLIKCCHCGVKGATVGCNVKNCGEHYHFPCARQINCTFMQ
DKTVYCPQHTVDATRKKCPVEKSFEINRSVYVELDRRKKKFVEPGKVQFMVGSLSVRKLG
HIVPMFSDHPDTIIPTDFECTRLYWSSKEPWKIVEYRIKTTIQNNNYCHGTDAGKNFTVD
HTMSSSSVHWGLTQINRWHSSLNNDEQELVEPVAGSSGLQKEQKTMKQLLEAVCGPSDDT
NDEEPQNNNDLLPQEIKDAIFEDIPHDILDGISMLDILPKLMTYDDLIAMDLKNENNFNA
EILKEVNVGGVGSSSSSSTTTSNSSNATGGTNDMDVDEDDINEAIMKCSGSELSNDGWMK
TISAPGIEDALLSAIKQPSTSRDLKRSKSVVRVAGQRSGSFSWNSKLESAAAAKRRKMSK
LADVLSLGRMKEDASGSALERRKSLPNEEFSWSANKKAGGAGESLNDGMNVFEKLKISQL
DGMDDFCGDAGEMKIYSSNMMEAPVKCDRCHATYRNQESYQRHLNSCEVLSTSESDSETR
SPRLLSPEQQQAQVATQLGAGTFILPQTSVAQTISTDMYGQISQNHNGNPTMVISGLNNQ
TINLNNLGNQAILSNIPASMPITINQLSSGIPIQTSAGTHQLPLQGTLSNLGGNMIISNQ
GQIFAQPVNFQQTLDNQQGFVQNKQRFQTAQLPQTISLANNIMNAGNSIQVLQQPQQHQQ
QQQIISIGPNGQPQIVTVTNPNQPQQQHFIQNQSQKKQLIFPSVSPKKPILSKYGQTPTP
IKAKRSPPSSTVTNSSKTVHMKKQEPIAIQQAPTFQTMQQQQQQQQQQQIQLINTSYPMI
RPNSAATPQQATTATAGNQIIFQQPNQPILVQQVGGNQISYVTDQNQVQYLAPTNVLTQN
GFTLNTAGDGTLSASPANNILIPNGTGGYSMIPASALQLATAPQPQVIGTIIQPQATSIQ
CGMMSTEQMVLGATAGTPTLEMVTDPTSGCMYLTSPSVYYGLETIVQNTVMSSQQFVSNA
AMHGVLSQNSSFSATTTQVFQASKIEPIVEVPTGYVVLNNDGTTSQLQTSNGIIQQAQIQ
PAPTPTPNPVVSQPMQTWKIEPQTTFVQQQQQPTVVNPLKSTTGSVKNIIPKTQTQLINK
VMPNTMIKTNPEPTINTSMMAQKVSYANASGVYTTTAAVTTTTKVSNVIKPITKTTTVNK
PKIVAKPVKQHRQSLLSPQPQLQHQVQQQIAQVPISQPQLVSIKPSINSSDKSLLQPIVS
IATNKLNNSHLKNSIEFIPTPSTKSTSLLKKPEVKHFPQRNTPNYAYQTSQAQPQQQPQS
IQISAIPTSYSQILPTPTSVQTTTQPQPQKSLLIDKKPSQITMSLASSSASSSMTPSIPP
TMSNSSITITPTQTASITLPTAPYPMQPLYSNIPTNVVNPIPQSNNSSNSISNTTPAQTN
RPTNRVLPMQASMVLPKSPEVPQTPPPLKLLNGSGLPCDKIDEISIIPSHTAFSPEPSPP
ASAKEDHLKGSPPRMEIEIKPIDPIDIGPMLPVESNQHQMEEQFGQLEPTPPPSFHLSLN
IDHHGSIIPITATTTMSTNSLLPPTIADIEIKPIESTNDEVDVPMEMVKCSLFGDAEDMI
AKSMQQDSMDGASSVDSRSMNDESESPEIKNKISEILDNLEAQTNEEEEFSECRESDSSE
LLLKIEEEPALGASSPIKSQEEQKLVEELNQELQASTHSSPASSIHHSELIIPSIFDPEP
KKDSDSSYKENLDPIANLASPAPSTSSNMMTTCSEPQQQLPEVLIKMKTCSQPPQPKSPK
SNSPKLLYEIQSQDGFTYKSTSIAEIWDKLFEAVQIARKAHGLQPLPEGQLEEMAGVQML
GLKTNAIRYLLEQLPGVEKCTQYQPQYHKKPMADITASVLGGASSAALYADYFDDIRENP
YGAARCEPYSARSEYDMFSWLASRHRKQPPMPVVAQTVDDTIIPR
NT seq 9498 nt NT seq  +upstreamnt  +downstreamnt
atggcggtgctgggtgacattggtctgaggaacgcaccatcggatccgtcggacggcccc
agtgaaccgacccccgcccgacccgcgtcctcgatcagcatcaacaatccgttcgcgaaa
actagtctgctggacgcagtttctggcactagtgcaagctgtaccagcagtagcggtacc
acgctgaagctcatgaaaccggcggtactgctgtcggccgcgacggcctccacgtcatct
agtctggcgtccgcgacgtcaatctttggtaaaagtattctccgccagccgcggctacag
ttcacgacctcgctgctcaactcgaacccgctggcgtcggatggtggttcgggcggtgct
gccccggaacgaaccaccgtttcggacgggccattttcgttgcatttgaaggcggggacg
gagttggattcgtccaagatattctccagcgcgttgacggcgagtggtggagcgagcgag
ggaacgccgtcgggggcttcgggtgcggttggaccgagttgcagtatttgtgggatcgcc
gacagtgggcgacaccatcaagccgggacggagaagcacggtattgggtgtcacacgtgc
cgcaagttcatctcgatgatcaagaagcgcaccaagggaccgaacccgtgcggagtgctc
aagtgtaagaacgatagcaagtgctccgtcaaaacgatggttcgaccgagtcacgtgagg
agtaatcacatattcaaggaacggtgccatgtttgctgggtgcgaaggtgtttgaccgga
tttccgttgccaccttcgttgaagactacgcttacccaaattcttccgccaatgagcagg
caggtcgattctacggcacctgctagtagcacttcagtcaagaaggagtcgtccattgag
aacaacatattctccaactctctcagcagtggacttcccacggtcgctgctccgcggata
ctttggaatacgagcacggaaaagtccgagttcccgaagacaagttccttcccatcgctg
tccaacccgttagctcaaaacaacagcacgttcggtagcttacctccgatcaagttgaac
atcagcgacaaaccacttatcctagcgccaagttcgttgggtagtccgaagatcgccaag
gaagaaatccctgtggctccaaccgtggaaaagaacctggaagaacctgaaccagtggca
agcacaacgaacccagatgtaactaccaaggttttgcgaccgcgcaacaaagccgaacct
gcgactcccacgccaaccagtacaaacaccgcgagcgtcagttcgccaccaccggtagtc
actacaacttccaccgtagtttcaccgacggccaccacaacaacgtctacagcagctgtt
acagcagatgcagctcgtcaacggatcgacctcaaaggtcctcgcgtcaagcacgtctgt
cgaagtgcgtcgatcgtgctgggtcaaccgttggccatgttccccgacgacgaggccgcc
gccgtcgacgctacgctggagaacattgaaacgccacccagcgatagtgccgccgaaggc
gcggacgacgtgcctgcggtatcgcaactaccgctaccactagaaccgacgaagcccagt
gaagagctgcagtcgccgtgtgcggactgcaaagaggaaccgccgaacctgaccctatcg
cctccggcgactcccgtggcggatgccgataccagtggttctacggaaaaggatctcgtg
atcgacgaagatcgcgtgtccgagtcgagcacgccgacgaaggaggttgaaccgcccaag
ccggaaacggagccacctgtagaagtcatacctgtagctactcctgcacccgttgtcgta
aaactggaactcgacgtcaaggagaagatcgaagtagcgcgaaagatcgaggagattgaa
cgaccaacgacgcgaaaggcaacttccgccatcaggccgcaagtgctcaagcagaacatc
aacgccataacgaagagcttcaacacgaacgtacgggctacggcgatcggccaacagacg
gttccggaagtgccaaacgcaccacttatttcgatcgatttctgggaaaactacgacccg
gccgaggtcagccgaacggggttcgggttgatcctatccgaggaagtcccgctgaaggcc
ctgtgctttctttgtggcagttccggcctggacgagatgttgttctgcgtgtgctgctgt
gaaccgtaccaccagtactgcgtcaaggacgagtacaacattcggcacgcatcgctggac
gaaaccaacatcagtctgctggagctaacctctacgaccatcgtcaacagctcacccgca
cagcaagcgctaaaccgcttcaactggatgtgtccgcggtgtacggtttgctacacctgt
aacatggccaccggaacgaaggtaaagtgtcaaaagtgctgcaaaaactatcacaccacc
tgcttgggcaccagcaagcgacttctcggcgccgatcgaccgatgatctgtgcggcctgt
ctcaagtgcaagagctgttcgacgaccaacgtaacgaaattcatcggcaatcttccgatg
tgtacgccgtgctttcggcttcgacaaaagggcaacttttgtccgctttgtcagcggtgt
tacgaggagaatgacttcgatcttaaaatgatggagtgtggcgactgtcaacggtgggtt
cacgccaagtgcgagggtctgaccgacgagcagtacaacatgctgagtgccctgccggaa
aacatcgaattcatctgcaaaaagtgtggcaaaaacaacgaatctgccaacgtatggcga
gatgcggtcgctgccgagttcaaggcaggtcttctgagcgtggtgaaactgctcagcaaa
agccgacaagcgtgcgcactgctgaagctgagtccccgcaagaagaccagcaactgcacc
tgtctcgtcagctccggcaaaagcatctctttcttcagctttggaacgtccaaggaagag
tccagcgtagcttcgaagaagcccaagctagacgaagactcaatctacgatttcaacagc
gaaagcagcagcagcagcacgagtttccccccggcgaccaagtgctactgctcgttgaag
ccggtgaaaccgtccgacatcagcctggtggaaatcaagcagaagatcaacgccaacgag
tactactcgctgcaagacttcaactacgacatgaacacgctcatcaactcgatcggctcg
gaagaactgtccacggcgtacaaagagttcctcagcgaaacgttcccgtggttccagaac
gaaaccaaggcctgcaccgacgcgctcgaggaagcgatgtgcggcgaagaaatgatgggc
ggtgactacgggctcgtcccaaccggagacgtccatctagagcaggaccaaaaggtcccg
agcatcgacattccgctcgacgaaatcgacgactacttttacgaatcttctgacgtcaaa
gacacccgaatctgcatgctctgcaaacaacccggcgagggacttccactgcacgagtcc
cgcctgctgtactgcggccaaaacaactggacgcacacaaactgcgctctctggtcggcc
gaagtttttgaggaaatcgacggttcactgcagaacgtccactcggccgcgtcccgcgga
cgtctgatcaagtgctgtcactgcggcgtcaaaggagccaccgtcggttgtaacgtgaag
aactgtggcgaacactaccacttcccgtgcgcccgccagatcaactgtaccttcatgcag
gacaagacggtgtactgtccgcagcacacggtcgatgccacgcgcaagaagtgtccggtg
gagaagagtttcgagatcaaccgatcggtgtacgtggagttagatcggcggaaaaagaag
tttgtcgagccgggcaaggtgcagttcatggtgggatcgctgagcgtgaggaagctcggc
cacatcgtaccgatgttcagcgatcacccggacacgatcattccgactgactttgagtgc
acccgtctgtactggagctcgaaggaaccgtggaagattgtcgagtacaggatcaaaaca
acgattcaaaacaataactactgtcatggaacagatgccgggaagaactttaccgtggat
cacacgatgagcagtagttccgtgcattggggactcacgcagatcaaccggtggcacagc
agcttgaacaacgatgagcaagagctggtcgaacctgtggcaggtagctcagggctacag
aaagagcagaaaacaatgaagcaactgctggaagcggtttgcggcccaagtgacgacaca
aacgacgaagaaccgcaaaacaacaacgatctgcttccgcaggagatcaaggatgccatc
ttcgaggatatcccgcatgacattctggatggaatcagcatgctggacatccttccgaag
cttatgacgtacgacgacctcattgcgatggatctgaagaacgaaaacaacttcaacgcg
gaaattctcaaagaagtcaacgttggaggtgtcggcagtagtagcagcagcagtacgacc
acctcgaacagtagcaacgccaccggcggaacgaacgacatggacgtcgacgaggacgat
atcaacgaggcgatcatgaagtgctccggcagcgagctcagcaacgacggctggatgaag
acgatatctgcgcccggaatcgaggacgcactgctcagtgcgatcaagcaaccgtcaacg
agtcgagatttgaagcggagcaagtccgtcgtacgcgtcgctgggcagcgatcggggagt
ttctcgtggaattcgaagcttgaatcggcggcggccgcgaagcgacgaaagatgagcaag
ttggcggatgttttgtcgctgggtcggatgaaggaggatgcgagtggaagtgctttggag
aggaggaagtcgttgccgaacgaggagttttcatggagtgctaacaagaaggctggaggt
gctggtgaaagtctgaacgatggaatgaatgtgtttgaaaagttgaagatctcccagctg
gatggaatggacgacttttgcggcgacgctggagagatgaagatctactcgtcaaacatg
atggaagccccggtcaagtgtgaccggtgccatgcaacgtaccggaatcaggagtcctac
cagagacatttgaactcgtgcgaagtgctgtctaccagtgagagtgactcggaaacgcga
tcgccacggctgcttagtcctgaacagcaacaggctcaagtggccacgcagctgggagcg
ggaacgttcatattgccccaaacgtcggtggcacaaacgatttctacggacatgtacggt
caaatcagccaaaaccataacggaaatccgacaatggtgatctccggtctcaacaaccag
accatcaacttgaacaacctgggaaatcaagcaatcctgtcgaacattccagcatcgatg
ccaatcacgatcaatcaactctcctccggaattcccatccaaacttcagccggcacccat
cagcttccactgcaaggtaccctctcgaatttgggtggaaacatgatcatctcgaatcag
ggtcaaatatttgcccaacccgtcaacttccagcagacgctcgataaccagcaaggtttc
gttcagaacaagcaacgatttcagactgcgcaacttccccagacgatttcgctggccaac
aacatcatgaacgccggtaacagcatccaggttctacaacagccgcaacaacaccaacaa
cagcagcagattatctcgattggtcccaatggtcaaccgcagattgtaactgtgactaat
ccgaaccagccacagcagcagcatttcatccaaaatcaatcgcaaaagaaacagctcatc
ttcccgtcggtgtctcccaagaagccgatcttgtccaagtacggccaaacgcccaccccg
atcaaagcgaagcgaagtcctccttcgtcgacggtgaccaactccagcaagacggtccac
atgaagaagcaagagccaatagctatccaacaagcgccaacgttccaaacaatgcaacaa
caacagcagcagcagcagcagcaacagatccagctgatcaacacttcgtacccgatgatc
aggccaaacagtgcggcgacgccacagcaagcaaccacggctacggccggaaaccagatc
atattccagcaaccgaatcaacccatactcgtgcagcaagttggcggcaatcagatctcg
tacgtaaccgaccagaaccaagtccagtatctggcaccgacgaatgtcctaacccagaac
gggtttacgctcaacaccgcaggcgatgggacactctcggcctcgcccgccaacaacatc
ctcatcccgaacggaaccggaggctactcgatgattccggccagtgctcttcagttggcg
accgcaccacaaccgcaggtgattggcacgatcatccagccccaagcaacctcgatccag
tgcggaatgatgtccacggaacagatggtcctgggagcgaccgccggcacgccgacgctg
gaaatggtcaccgaccctacgtcgggctgcatgtacttgaccagtccatcggtgtactac
gggctggaaacgatcgttcaaaacacggtcatgtcatcgcagcagttcgtttccaatgca
gccatgcacggagtgctcagccaaaactcgagcttctccgccaccacaacgcaggtattc
caggcaagcaagatcgaaccgatcgttgaagttccgacgggttatgtggtgctcaacaac
gacggaaccacctcccaactgcaaacctctaacggaatcatccagcaggctcagattcag
ccggcaccaacgcctacccccaacccagtcgtcagtcaaccaatgcaaacgtggaagatt
gaaccgcaaaccacgttcgttcagcaacagcaacaacccaccgttgtgaatccgctcaag
tcaactacgggatcggtcaagaacatcattcccaagactcaaacgcaactgatcaacaag
gtaatgccgaacacgatgatcaaaactaacccggaacccaccatcaacacttcgatgatg
gcccagaaggtcagctacgccaacgcttccggcgtgtacacgactacggcggccgtcaca
acgaccaccaaggtgtccaacgtgatcaagcccataaccaagaccaccaccgtgaacaag
ccgaaaatcgtggccaagccagtcaaacagcatcgccagtctctgctgtctccacaaccg
caactacagcaccaggttcagcaacagattgcccaagtcccgatctcccaaccccaactg
gtatcgatcaagcccagcattaacagctcggacaagtcactgcttcaaccaatcgtgagc
atcgctaccaacaagctaaacaatagtcacctgaagaactcgattgagttcattccgacg
ccgtcaacgaagtcaacgtccctactgaagaagcccgaagttaagcatttcccacagcga
aacactccgaactacgcgtaccaaactagtcaagcccagccgcagcagcagccacaatcc
atccagatcagcgccatcccaacctcctacagtcagatccttccaacgccaacgtccgta
caaacgacgacgcaaccacaaccccaaaagtcgctgctgatcgacaagaaaccatcccag
atcacgatgtcactcgcttccagcagtgccagttcttcgatgactccatcaatcccaccc
acgatgagcaattcgtcgatcacgatcacgccaacgcaaacggcaagcataacgctgccg
acggctccgtacccgatgcaaccactgtactccaacattccgaccaacgtggtcaatccg
atcccgcaatccaacaacagtagcaacagtattagcaacacgacacccgcccagacgaac
cgccccacgaaccgcgttctacccatgcaagcctcgatggttctgcctaaatcacccgaa
gtcccgcagacgccacctccgctgaaactgctcaacggtagtggcttgccgtgcgataag
atcgacgaaatctcgatcattcccagtcacaccgcgttcagtccggaaccgtcaccgccg
gcatcggccaaggaggaccacctcaagggttcgccgccccgcatggagatcgagatcaaa
ccgatcgatccgatcgacatcggaccgatgcttccggtggaatcgaaccaacaccagatg
gaagaacaatttggccagctcgaaccaaccccgccgccaagcttccacttgagtttgaac
attgatcatcacggatccatcatcccaatcacggcgacgacgacgatgagcacaaactcg
ctgctgccgccgaccatcgccgacatcgagatcaaacccatcgaatcgacgaacgacgaa
gtggacgtcccaatggagatggtcaagtgttcgctgtttggtgacgccgaagatatgatc
gccaagagcatgcagcaggactcgatggacggtgcgagcagcgtagattcgcgcagcatg
aacgacgagtcagagtcgcccgagatcaagaacaagatttcggagattttggacaacctg
gaggcgcaaaccaacgaggaggaagagttcagcgagtgtcgcgaatcggacagctcggaa
ctgctgttgaagattgaggaggaacccgcgctgggagcttccagtccgatcaagagtcag
gaggagcaaaagcttgtcgaggaactgaaccaggagctgcaagccagcacgcactcgtca
ccggcaagctcgatccaccactcggaactgatcatcccgtcgatctttgaccctgaaccg
aaaaaggacagcgattccagctacaaggagaacctcgacccgatcgcgaacctagcgagt
cctgctccgagcacaagcagcaacatgatgaccacctgcagcgaaccacaacaacagctg
ccggaagtgctgatcaagatgaagacctgcagccagccaccacagcccaaatcgcccaag
tccaacagccccaaactgctgtacgagatccaatcgcaggacggcttcacctacaagtcc
acctcgatcgcggaaatctgggacaagctgttcgaggcggtgcagatcgcacgcaaagcc
cacggcctgcagcccctgcccgagggtcagctggaggagatggccggcgtgcagatgctc
ggcctcaaaacgaacgccatccggtacctgctcgagcagctgccgggtgtggagaagtgc
acccagtaccagccccagtaccacaagaaaccgatggcggacatcaccgcgtccgtgctg
ggtggcgcttcctcggcggccctctacgcggactactttgacgacatccgcgagaacccg
tacggtgcggcccgctgcgagccgtacagcgcccggtccgagtacgacatgttcagctgg
ttggcgtcgcgccaccgtaagcaaccgccgatgccggtcgtggcgcaaaccgtcgacgat
accatcattccgaggtaa

DBGET integrated database retrieval system