KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ014085Help
Entry
CpipJ_CPIJ014085  CDS       T01079                                 

Definition
nucleoporin-17
Orthology
K14298  
mRNA export factor
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    CpipJ_CPIJ014085
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 361 aa AA seqDB search
MFGAQTLGGASAFGGTTAVAPVNPMKDFEVTSPPEDTVSAMEFSPATLQQNFLIAGSWDS
SVRCWEVEQSGKTVGKSIKTMGGPVLDVCWADDGSKVFIASADKQVKCWDLASDQVVQVA
QHDAPIKTCHWVKGTNYTCLMTGSWDKTLKFWDTRTPQPMMSIQLPERCYCADVDYPMAV
VGTAGRHVLIYSLENKPTQYKQQESPLKYQHRTVSIFRDKKKTPTGYALGSIEGRVAIQY
VNPINPKDNFTFKCHRSNGSSGYQDIYAVNDIAFHPIHGTLATVGSDGTFSFWDKDARTK
LKSSEAMDQSITKCCFNANGQIFAYTVGYDWSKGHEYNNPQKKTYIFLRSCYEELKPRAT
S
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgttcggcgcgcaaactctgggcggcgcttccgcctttggaggcaccacggcggtggcc
ccggtcaacccgatgaaggactttgaggtgacgtccccgccggaggacaccgtgtcggcg
atggagttcagtccggcgacgttgcagcagaactttctgatcgccggcagctgggacagc
agcgtgcgctgttgggaggtcgagcagagcggcaaaacggtcgggaagtcgatcaagaca
atgggcggaccggtgctggacgtgtgctgggcggacgatggcagcaaggtgtttatcgcg
tccgccgataagcaggtcaagtgctgggatttggcgtcggaccaggttgttcaggtggcc
cagcacgacgctccgatcaagacgtgccactgggtcaagggcaccaactacacctgcctc
atgaccggatcgtgggacaaaacgctgaagttctgggacacgcgaacgccccagccgatg
atgtcgatccagctgccggaacggtgctactgcgcggacgtggactatccgatggccgtg
gtgggaaccgccggacggcacgtccttatctactcgctggaaaacaaaccaacccagtac
aagcagcaggagagtccgctcaagtaccagcaccgaacggtttcgatcttccgcgacaag
aagaaaactccaaccggatacgcgctcggttccatcgaaggtcgcgtggccatccagtac
gtgaacccgatcaacccaaaggacaacttcaccttcaagtgtcaccgctcgaacggttcc
tccggctatcaggacatttacgccgtcaacgacattgcgtttcatccgatccacggcacc
ttggcgacggtcggttcggacggaacgttcagcttctgggacaaggacgcccgtaccaag
ctcaagtcgtcggaagcgatggaccagtccatcaccaagtgctgcttcaacgccaacggg
cagatcttcgcgtacaccgtggggtacgattggtccaagggtcacgagtacaacaaccca
cagaaaaagacgtacatcttcctgcgctcgtgctacgaggagcttaagccgagggcgacc
agttaa

DBGET integrated database retrieval system