KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ014293Help
Entry
CpipJ_CPIJ014293  CDS       T01079                                 

Definition
ubiquitin specific protease 2
Orthology
K11833  
ubiquitin carboxyl-terminal hydrolase 2/21 [EC:3.4.19.12]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Brite
Enzymes [BR:cqu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     CpipJ_CPIJ014293
Peptidases [BR:cqu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CpipJ_CPIJ014293
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 142 aa AA seqDB search
MDEFVREEVMDGLDQVYCSKCKARRRCTKSMAIERFPKYLVIHLKRFSETRWSKLTNVIE
FPTGERELNLQQYASEDHQGPVNYSLYGISNHMGSTAGGHYIAVCKHPISKEWNEFNDNF
VSETSERSLVTSSAYVLFYERA
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atggacgagttcgtgcgcgaggaggtcatggacgggctggaccaggtgtactgctccaag
tgcaaggcccgccggaggtgcaccaagagcatggcgatcgagcggttccccaaatacctg
gtgatacacctgaaacgcttctcggaaacgcggtggagcaaactgaccaacgtcatcgag
ttccccacgggtgagcgggagctgaacctgcaacagtacgcgtccgaggaccaccaggga
ccggtcaactactcgctgtacgggatttcgaaccatatgggatctaccgccggtggtcac
tacatcgctgtttgcaagcatccgatcagcaaggaatggaacgaattcaacgataacttc
gttagcgaaacttccgaacgcagtctggtgacatctagtgcctacgtgttattctacgag
cgagcgtaa

DBGET integrated database retrieval system