KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ014293Help
Entry
CpipJ_CPIJ014293  CDS       T01079                                 

Definition
(RefSeq) ubiquitin specific protease 2
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
VectorBase: 
UniProt: 
AA seq 142 aa AA seqDB search
MDEFVREEVMDGLDQVYCSKCKARRRCTKSMAIERFPKYLVIHLKRFSETRWSKLTNVIE
FPTGERELNLQQYASEDHQGPVNYSLYGISNHMGSTAGGHYIAVCKHPISKEWNEFNDNF
VSETSERSLVTSSAYVLFYERA
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atggacgagttcgtgcgcgaggaggtcatggacgggctggaccaggtgtactgctccaag
tgcaaggcccgccggaggtgcaccaagagcatggcgatcgagcggttccccaaatacctg
gtgatacacctgaaacgcttctcggaaacgcggtggagcaaactgaccaacgtcatcgag
ttccccacgggtgagcgggagctgaacctgcaacagtacgcgtccgaggaccaccaggga
ccggtcaactactcgctgtacgggatttcgaaccatatgggatctaccgccggtggtcac
tacatcgctgtttgcaagcatccgatcagcaaggaatggaacgaattcaacgataacttc
gttagcgaaacttccgaacgcagtctggtgacatctagtgcctacgtgttattctacgag
cgagcgtaa

DBGET integrated database retrieval system