KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ014417Help
Entry
CpipJ_CPIJ014417  CDS       T01079                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CpipJ_CPIJ014417
   00670 One carbon pool by folate
    CpipJ_CPIJ014417
Enzymes [BR:cqu01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     CpipJ_CPIJ014417
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 182 aa AA seqDB search
MKKFSLIVAVCSNGGIGIKGDLPWRLRSELRHFARMTKRVADPGKRNAIIMGRKTYFGIP
EGRRPLPDRLNVVLTRDPASNTYPEGVLVCTSLEDALAKIQDLVENIWIIGGSAVYKEAM
ESRHCHRIYLTEILAPFECDAFFPEIGKEFRLVGNDADLAEEVQEENGVRFQYKIYEKKD
ID
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagttttcactaatcgtggccgtttgctcgaacggtggaatcggcatcaagggt
gatctgccctggcggttgagatccgagctgcggcactttgcccgaatgaccaaacgggtc
gctgaccccggcaagcgcaacgccatcatcatgggccgcaagacgtactttggcatcccg
gaaggcagacgtcccctgccggaccgtctgaacgtcgtgctaacgcgcgaccccgcctcg
aacacctatccggaaggggttttggtttgcaccagcttggaagatgctctggcgaaaatc
caggacctggtggaaaatatctggattattggaggaagcgcggtgtacaaggaggccatg
gagtcgcggcattgccatcggatttacttgaccgagatattggccccgttcgagtgtgat
gcgttctttccggagatagggaaggagttccggctggtggggaacgatgccgatttggcc
gaggaagtgcaggaggagaatggggtgcggtttcagtataagatttacgaaaagaaggac
attgattaa

DBGET integrated database retrieval system