KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ014461Help
Entry
CpipJ_CPIJ014461  CDS       T01079                                 

Definition
mannosyltransferase 1
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    CpipJ_CPIJ014461
Enzymes [BR:cqu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose-protein mannosyltransferase
     CpipJ_CPIJ014461
Glycosyltransferases [BR:cqu01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   CpipJ_CPIJ014461
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 639 aa AA seqDB search
MPTDSEIFGFFQKRGWHAESLVAMFRAPREHCVYVKFKTEELLTAALLECPSSEAFLNWW
ILFGAILVLTVGTRFYNVTIPDHVCWDETHFGKMGSWYINRTFFFDVHPPLGKMLIGLSG
YLTGYDGKYPFDKPGDKYNGTHYEGMRIFCTALGAAIVPMSFHTVWDMTGSLMASAFAAA
YILFDIGMLILNRYILLDPPLIFFMTASVMGMARVSKLTREGHSFGSSWWSWLSFTGGML
ACTISVKFVGLFVVLLVGLHTASDLWDVLGDLSRPIWYTVKQLAARALTLIVLPIVLYAT
FFYIHLAVLNHSGSGDGFYSSGFQSNLVGNSLYNVSMPRQVAYGAIVTLKNHKTGGGYLH
SHNHLYPKGFGAQQQQVTTYSHKDENNKWILKPYNEQSTANVTVVKHGDLIRLEHVPTGR
NLHSHREQAPVTKKHMQVTCYGETGVGDSNDVWQVRILGGRDGDVVETVTSRLVLYHYIE
RCVLTTTTKQLPKWGFEQQEVTCNPNIRDRAAVWNVEDNQFDKLPSVNFQVYAPGFLSRF
FESHAVMLQGNSGLKPKEGEVTSRPWQWPINYRGQFFSGSEHRVYLLGNPVIWWSNLAFL
ALFVVVFLVEIVKQQRAGDQSETGNGENGEFVMFKLGSN
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atgccaacggacagcgaaatcttcggcttcttccagaagcgtggatggcacgcagaatct
ttagtggccatgttccgggcaccccgcgagcactgtgtctatgtgaaattcaaaacagag
gagctcttgacggctgcattgctggaatgtccatccagcgaggcgtttctcaactggtgg
atcctgttcggggcgatcctcgtgctgacggtgggcacccggttttacaatgtgaccatc
ccggaccacgtttgctgggacgagacgcactttggcaagatgggcagctggtacatcaac
cggacgttcttcttcgacgtgcacccaccgctgggcaagatgctgatcgggctttccggg
tatttgaccgggtacgatgggaagtacccgttcgataagccgggggacaagtacaacggg
acgcactacgaggggatgcggattttctgcaccgcccttggcgccgccatcgtcccgatg
tccttccacacggtgtgggacatgacgggatcgctcatggcttccgcgtttgccgccgcc
tacattctgttcgacattgggatgctcatcctgaaccggtacatcctgctggatccaccg
ctgatctttttcatgaccgcctcggtcatgggaatggcgcgggtgtccaagttgacccgg
gagggtcacagctttggatccagttggtggagttggctcagcttcaccggaggtatgctg
gcctgtacgatcagcgtgaagttcgtggggttgtttgtggtgctgctcgttggactccac
acggcttcggatctctgggacgtcctcggtgacttgagcagaccgatttggtacacggtg
aagcagctggctgctcgagcactgactttgatcgttctcccgatcgtgctgtacgccacc
ttcttctacattcacctggcggtcctcaaccactccggcagtggagatggattctacagc
tcgggattccagtcgaacctcgtcggaaactcgctgtacaacgtgtcgatgcctcggcag
gtcgcgtacggagcgatcgtaacgctgaagaaccacaaaaccggaggcggttacctgcac
tcccacaaccatctctatccgaagggatttggagcgcagcagcagcaggtcaccacgtac
agccacaaggacgaaaacaacaagtggattttgaagccgtacaacgagcagagtacggcc
aatgtgaccgtggtcaagcacggggatttgatccggctggagcacgtgccaacggggagg
aatttgcactcgcaccgggaacaggcgccagtgacgaagaagcacatgcaagtgacgtgc
tatggggagaccggtgtcggtgactcgaacgacgtgtggcaggttcgaatcctgggtggg
cgcgatggagacgtcgtagaaaccgtaacgagccggctggtgctgtaccattacatcgaa
cggtgcgtgctgacgaccacgaccaagcaactaccgaagtggggcttcgagcagcaggag
gtcacatgcaatccgaacatccgggaccgggccgccgtatggaacgtggaggacaaccag
tttgacaaattgccgagcgtaaactttcaagtgtacgcacctggcttcctaagtcggttc
tttgagtcgcacgccgtcatgctgcagggcaattcggggctgaagcccaaggagggggaa
gtgacgagccgaccctggcagtggccgatcaattacaggggtcaattcttctccggttca
gagcatcgcgtctatctgctgggcaatcccgtcatctggtggagcaatctggcctttctg
gcgctgtttgtggtggtcttcctggtggagatcgtcaagcagcagagggctggggatcaa
tccgagaccggcaatggggaaaatggtgagtttgtaatgtttaagcttggaagcaactag

DBGET integrated database retrieval system