KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ014603Help
Entry
CpipJ_CPIJ014603  CDS       T01079                                 

Definition
(RefSeq) calcineurin b subunit
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    CpipJ_CPIJ014603
Protein phosphatases and associated proteins [BR:cqu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     CpipJ_CPIJ014603
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9 DUF1398
Motif
Other DBs
NCBI-GeneID: 6047846
NCBI-ProteinID: XP_001864848
VectorBase: CPIJ014603
UniProt: B0X5C6
AA seq 170 aa AA seqDB search
MGNETSLPMELCSNFDADEIRRLGKRFKKLDLDNSGALSIDEFMSLPELQQNPLVQRVID
IFDADGNGEVDFKEFIQGVSQFSVKGDKLSKLRFAFRIYDMDNDGFISNGELFQVLKMMV
GNNLKDTQLQQIVDKTIVFADKDEDGKISFEEFCSVVGNTDIHKKMVVDV
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatgaaacatctctgccgatggagctgtgctcaaacttcgacgccgacgagatc
cggcgtctgggtaagcgcttcaagaagctcgacctggacaactcgggcgccctgagcatc
gacgagttcatgtcgctgccggagctgcagcagaatccgctcgttcagcgcgtcatagac
atcttcgacgcggacggtaacggcgaggtggactttaaggagttcatccagggcgtttcg
cagttcagcgtgaagggcgacaagctgtccaagcttaggtttgcgttccgaatatacgac
atggacaacgacggattcatctcgaacggggagctgtttcaggtgctaaaaatgatggtc
ggcaacaacctgaaggacacccagctgcagcagatcgtcgacaagaccattgtgttcgcc
gacaaggacgaggacggcaaaatttccttcgaagagttctgctcggtggtgggcaacacc
gacatccacaaaaagatggtcgtcgacgtttaa

DBGET integrated database retrieval system