KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ014603Help
Entry
CpipJ_CPIJ014603  CDS       T01079                                 

Definition
calcineurin b subunit
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    CpipJ_CPIJ014603
Protein phosphatases and associated proteins [BR:cqu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     CpipJ_CPIJ014603
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 170 aa AA seqDB search
MGNETSLPMELCSNFDADEIRRLGKRFKKLDLDNSGALSIDEFMSLPELQQNPLVQRVID
IFDADGNGEVDFKEFIQGVSQFSVKGDKLSKLRFAFRIYDMDNDGFISNGELFQVLKMMV
GNNLKDTQLQQIVDKTIVFADKDEDGKISFEEFCSVVGNTDIHKKMVVDV
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatgaaacatctctgccgatggagctgtgctcaaacttcgacgccgacgagatc
cggcgtctgggtaagcgcttcaagaagctcgacctggacaactcgggcgccctgagcatc
gacgagttcatgtcgctgccggagctgcagcagaatccgctcgttcagcgcgtcatagac
atcttcgacgcggacggtaacggcgaggtggactttaaggagttcatccagggcgtttcg
cagttcagcgtgaagggcgacaagctgtccaagcttaggtttgcgttccgaatatacgac
atggacaacgacggattcatctcgaacggggagctgtttcaggtgctaaaaatgatggtc
ggcaacaacctgaaggacacccagctgcagcagatcgtcgacaagaccattgtgttcgcc
gacaaggacgaggacggcaaaatttccttcgaagagttctgctcggtggtgggcaacacc
gacatccacaaaaagatggtcgtcgacgtttaa

DBGET integrated database retrieval system