KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ014621Help
Entry
CpipJ_CPIJ014621  CDS       T01079                                 

Definition
enoyl-CoA hydratase, mitochondrial
Orthology
K07511  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Carbon metabolism
Fatty acid metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Fatty acid biosynthesis, elongation, mitochondria
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CpipJ_CPIJ014621
   01212 Fatty acid metabolism
    CpipJ_CPIJ014621
  Carbohydrate metabolism
   00640 Propanoate metabolism
    CpipJ_CPIJ014621
   00650 Butanoate metabolism
    CpipJ_CPIJ014621
  Lipid metabolism
   00062 Fatty acid elongation
    CpipJ_CPIJ014621
   00071 Fatty acid degradation
    CpipJ_CPIJ014621
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CpipJ_CPIJ014621
   00310 Lysine degradation
    CpipJ_CPIJ014621
   00380 Tryptophan metabolism
    CpipJ_CPIJ014621
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CpipJ_CPIJ014621
Enzymes [BR:cqu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CpipJ_CPIJ014621
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 293 aa AA seqDB search
MANIGKIFASRACGLAKAANYSNNVRFYCCASPKAFEFIKTELVGEKKNVALITLNRPKA
LNALCNGLMSEVSQALDQFEADSTVGAIVITGSEKAFAAGADIKEMQPNTYAKCIMGNFL
NNWTRVAQAQKPVIAAVNGYALGGGCEFAMMCDIIYAGDKAKFGQPEIALGTIPGAGGSQ
RTTRVMGKSKAMEMCLTGNMINAEEAERSGLVSKVFPADKVVGEAIKLGEKISTFSPLIV
QLCKEAVNTAYETTLHEGLKFERRHFHATFSTKDRQEGMTAFVEKRAPKFISE
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacattggcaagatttttgcttcccgtgcctgcggcctggccaaggcggccaac
tacagcaacaatgtgcgcttctactgctgcgcttccccgaaggcgtttgagttcatcaag
accgagctggtgggtgagaagaagaacgtcgccctgatcacgctgaaccgccccaaggcc
ctgaacgccctctgcaatgggctgatgagcgaggttagccaggcgctggaccagttcgaa
gccgacagcaccgtcggagcgatcgtcatcaccggcagcgagaaggcgttcgcggcggga
gctgacatcaaggagatgcagccgaacacctacgccaagtgcatcatgggtaacttcctg
aacaactggactcgcgtcgcccaggcccaaaagccggtgatcgccgccgtcaacggatac
gcgctcggcggtggttgcgaattcgccatgatgtgcgacatcatctacgccggcgacaag
gccaagttcggccagccggagattgccctcggaacgattcccggagccggcggttcccag
cgcaccacccgcgtcatgggcaagtccaaggccatggagatgtgcctcaccggaaacatg
atcaacgctgaggaagcggaacgttcgggtctcgtaagcaaggtcttccctgccgataag
gtcgttggggaagccatcaagctgggcgagaagatctccaccttctccccgctgatcgtg
cagctgtgcaaggaagcggtcaacacggcgtacgaaaccaccctccacgagggactcaag
ttcgagcgtcgccacttccacgctaccttctcgaccaaggatcgccaggagggtatgacc
gcgttcgttgagaagcgcgcacccaagttcatcagcgaataa

DBGET integrated database retrieval system