KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ014664Help
Entry
CpipJ_CPIJ014664  CDS       T01079                                 

Definition
NADPH-cytochrome P450 reductase
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 679 aa AA seqDB search
MDAQTEPEVPPVAAATEEPFLGPLDIVLLLVLVAGAAWYLLKNKKKEAQTSQFKSYSIQP
TAVNTMTMAENSFIKKLKSSGRRLVVFYGSQTGTAEEFAGRLAKEGLRYQMKGMVADPEE
CDMEELLTLKDIDKSLAVFCLATYGEGDPTDNCMEFYEWIQNNDVDFTGLNYAVFGLGNK
TYEHYNKVGIYVDKRLEELGASRVFELGLGDDDANIEDDFITWKDKFWPAVCDHFGIEST
GDEVLTRQYRLLEQPETSPERLYTGEVARLHSLQTQRPPFDAKNPFMAPIKINRELHKSG
GRSCMHIEFDIEGSKMRYEAGDHLAMYPVNDSDLVTRLGKLCNADLDTIFSLINTDTDSS
KKHPFPCPTTYKTALTHYLEITALPRTHILKELAEYCSDEKDKEFLRFMSSTAPEGKAKY
QEWVQDSSRNIVHVLEDVPSCHPPIDHICELLPRLQPRYYSISSSSKLYPTTVHVTAVLV
KYVTKTGRTNNGVATTFLAQKKVNGESLPRVPIFIRKSQFRLPAKTETPVIMVGPGTGLA
PFRGFIQERDFNKQEGKEIGQTVMYFGCRKRSEDYIYEEELEDYVKRGVISLRTAFSRDQ
PQKVYVTHLLEEDMDLIWEVIGVNKGHFYICGDAKNMATDVRNILLKVLQSKGNMSESEA
TQYVKKMEAQKRYSADVWS
NT seq 2040 nt NT seq  +upstreamnt  +downstreamnt
atggacgcacagacagagccggaagtgcccccggtggcggcggcaaccgaggagcccttc
ctgggcccgctagacattgtcctgctgctggtgctggtggccggtgcagcatggtacctg
ctcaagaacaagaagaaggaagcccagactagtcagttcaagtcgtactcgatacagccc
accgccgtcaacacgatgaccatggcggagaactccttcatcaagaagctgaagtcgtcc
ggtcgacggctggtggtgttctacggctcgcagaccggaaccgccgaggagttcgccggg
cggttggcgaaggagggcctgcgctaccagatgaagggtatggtggccgacccggaggag
tgcgacatggaagagctgctgacgctcaaggacatcgacaagtcgctggcggtgttctgc
ttggccacgtacggcgagggtgatcccaccgacaactgcatggagttctacgagtggatc
cagaacaacgacgtggactttaccgggttgaactacgcggtctttgggcttggcaacaaa
acgtacgagcactataacaaggttggaatctatgtcgacaaacggctggaggagttggga
gcaagtcgtgtcttcgagctgggacttggagatgatgacgcgaacattgaggatgacttc
atcacgtggaaggacaagttctggccagcagtgtgcgaccattttggaatcgaaagtacc
ggcgacgaggtgttgacgcgtcagtaccgtctgcttgagcagccggagacctcgccggaa
cgtctgtacaccggtgaggtggcccgcctgcactcgctccagacgcagcgcccgccgttc
gatgccaagaatccgttcatggctccgatcaagattaaccgcgagctgcacaagtccggt
ggccgttcgtgcatgcacatcgagttcgatatcgagggatcgaagatgcgctacgaagct
ggtgatcatctggcgatgtacccggtgaacgattcggacttggtgacccgattgggcaag
ctgtgcaatgccgacctggatacgatcttctcgctgatcaacaccgatacggacagtagc
aagaaacatccgttcccttgcccaacgacgtacaaaacggcgctgacgcactacctggag
atcaccgcgctgccgagaactcacatcctgaaggagttggccgaatactgcagcgacgaa
aaggacaaggagttcctgcggttcatgtcttccacggcacccgaaggcaaggccaagtac
caggaatgggttcaggacagcagccgtaacattgtgcacgtactggaagacgtcccgtcc
tgccatccaccgattgaccacatctgcgagctgcttccgagactgcagccccgctactac
tcgatctcttcgtcttccaagctgtaccctaccacggtgcacgtcacggccgttctggtc
aagtacgtcaccaagaccggacgtaccaacaacggcgtcgctacgacattcctggcccag
aagaaggttaacggagaatcgctgccgcgggtgccgatcttcatccgcaagagccagttc
cggttaccggcgaaaacggaaaccccggtcatcatggtcggcccgggaaccgggttggct
cccttccgaggctttatccaggagcgagatttcaacaagcaggaaggcaaggaaatcggc
cagaccgtcatgtactttggctgtcgcaaacggtccgaggattacatctatgaagaggaa
ctcgaagactacgtcaagcgcggcgtaatcagcctgaggacagccttctcgcgtgaccaa
ccgcaaaaggtgtacgttacgcatctgctagaggaagacatggacctgatctgggaagtg
ataggtgtcaacaagggtcacttctacatttgcggtgacgccaagaacatggccaccgac
gtgcggaacattctgctcaaggtgctgcaatccaagggcaacatgagcgagagtgaagcg
acgcagtacgtcaagaagatggaagcccagaagcggtactcggccgacgtgtggagttaa

DBGET integrated database retrieval system