KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ014857Help
Entry
CpipJ_CPIJ014857  CDS       T01079                                 

Definition
GTP cyclohydrolase i
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CpipJ_CPIJ014857
Enzymes [BR:cqu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     CpipJ_CPIJ014857
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 321 aa AA seqDB search
MNQSRYEISDDADVLNQEIDDTNFPRSNSSLGNGSVSSLNGFGGGTTAFAARRRSSSLRK
TESESFDDESGQQQPPEANGTGETNGTATDNTATAAGPGVNRAEPAPLRTTSFSGHEKCT
FHHDLELDHKPSTREDLLPLMSRSYRMLLSSLGEDPERQGLLKTPERAAKAMLFFTKGYD
QSLEEALNGAVFDEDHDEMVVVKDIEMFSMCEHHLVPFYGKVSIGYLPCKKILGLSKLAR
IVEIFSRRLQVQERLTKQIAVAVTQAVQPAGVAVIIEGVHMCMVMRGVQKINSKTVTSTM
LGVFRDDPKTREEFLTLCNNK
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaaagtcgttacgagatctcagatgacgccgacgtgctgaaccaggagattgac
gacaccaacttcccgcggagcaactccagcctcggcaacggttccgtcagcagtctgaac
ggattcggcggtgggactacggcctttgcggcccgccgacgatccagcagtctgcgcaag
accgagtccgaatcgttcgacgatgagtccggtcagcagcagccgccggaagccaacggg
acgggggagaccaacggaacagcgacggataataccgctacggcggcaggtcccggggtg
aaccgggctgaaccggctccgctgaggaccaccagcttctcaggacacgagaaatgcaca
ttccaccacgacctggagctggaccacaagccgtcgacccgggaggacctgctgccgctg
atgtcccgctcgtaccggatgctgctgagcagcctcggcgaggaccccgaacgacagggt
ctgctgaaaactccggaacgtgccgccaaagcgatgcttttcttcaccaaaggatacgac
caaagcttggaggaggccctcaacggtgccgtgttcgacgaggaccacgacgagatggtg
gtggtgaaggacatcgagatgttctccatgtgtgagcatcacctggttccgttctacggc
aaggtttcgatcggttatctgccctgcaagaagattctgggactgagcaaactggccaga
atcgtcgagatcttctcccgccggctgcaggtccaggagcggctgaccaaacagattgcc
gtggccgtcacccaggccgttcagcccgctggagtcgccgtcatcatcgagggagtccac
atgtgcatggtcatgcggggcgtccagaagatcaacagcaagacggtcacctccacgatg
ctcggcgtgttccgcgatgatcccaagacccgggaggagttccttacgctgtgcaacaat
aagtaa

DBGET integrated database retrieval system