KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ014882Help
Entry
CpipJ_CPIJ014882  CDS       T01079                                 

Definition
clathrin heavy chain
Orthology
K04646  
clathrin heavy chain
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
Lysosome
Endocytosis
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    CpipJ_CPIJ014882
   04142 Lysosome
    CpipJ_CPIJ014882
Exosome [BR:cqu04147]
 Exosomal proteins
  Proteins found in most exosomes
   CpipJ_CPIJ014882
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 1666 aa AA seqDB search
MLTNININPSSISFTNLTMESDKFICVRERVGETAQVVIIDMNDAQNPIRRPISADSAIM
NPASKVIALKAQKTLQIFNIEMKSKMKAHAMTEEVVFWKWITLNTLSLVTETSVYHWSME
GDSTPVKMFDRHSSLNGCQIINYRTDPKQAWLLLVGISAQQNRVIGAMQLYSVERKVSQA
IEGHAASFATFKMEENKETSTLFCFAVRSATTAKLHIIEVGAPPTGNTAFTKKAVDVFFP
PEAGSDFPVAMQVSPKYDVIYLITKYGYIHMYDIETATCIYMNRISADTIFVTAPHESSG
GIIGVNRKGQVLSVTVDEEQIIPYINSVLQNPDLALRMAVRNNLSGAEDLFVRKFNHMFQ
NGQYAEAAKVAAIAPKGILRTPQTIQKFQQVPAQPGTNSPPLLQYFGILLDQGKLNKYES
LELCRPVLAQGRKQLCEKWLKEEKLECSEELGDLVKPSDPTMALSIYLRSNVPNKVIQCF
AETGQFQKIVLYAKKVNYNPDYIFLLRSVMRTNPEQGAGFASMLVADEEPLADINQIVDI
FMEQNMVQQCTAFLLDALKNNRPSEGSLQTRLLEMNLMSAPQVADAILGNAMFTHYDRAH
IAQLCEKAGLLQRALEHYTDLYDIKRAVVHTHLLNGDWLVGFFGTLSVEDSLECLKAMLT
ANIRQNLQICVQIATKYHEQLTTKALIDLFESFKSYEGLFYFLGSIVNFSQDPEVHFKYI
QAACKTNQIKEVERICRESSCYNAERVKNFLKEAKLTDQLPLIIVCDRFDFVHDLVLYLY
RNSLQKYIEIYVQKVNPSRLPVVVGGLLDVDCSEDIIKNLILVVKGQFSTDELVEEVEKR
NRLKLLLPWLESRVHEGCIEPATHNALAKIYIDSNNNPERFLKENQFYDSRVVGRYCEKR
DPHLACVAYERGHCDRELIAVCNENSLFKSEARYLVRRRDPELWADVLSEANPYKRQLID
QVVQTALSETQDPDDISVTVKAFMTADLPNELIELLEKIVLDSSVFSDHRNLQNLLILTA
IKADRSRVMDYINRLDNYDAPDIANIAINNELYEEAFAIFKKFDVNTSAIQVLIEQVHNL
ERANEFAERCNEPAVWSQLARAQLQQGLVKEAIDSYIKADDPSAYIDVVETASKNESWED
LVRYLQMARKKARESYIESELIYAYARTGRLADLEEFVSGPNHADIQKIGDRCFNDKMYE
AAKLLYNNVSNFARLAITLVHLKEFQGAVDGARKANSTRTWKEVCFACVDAEEFRLAQMC
GLHIVVHADELEDLITYYQDRGHFEELIGLLEAALGLERAHMGMFTELAILYSKYKPAKM
REHLELFWSRVNIPKVLRAAEQAHLWSELVFLYDKYEEYDNAVLAMMAHPTEAWREGHFK
DIITKVANIELYYRAIQFYLDYKPLLLNDILLVLAPRMDHTRAVNFFTKQGHLQLVKTYL
RSVQSLNNKAINEALNGLLIDEEDYQGLRTSIDAFDNFDNIALAQKLEKHELTEFRRIAA
YLYKGNNRWKQSVELCKKDRLFKDAMEYAAESHQGELAEELLGWFLERGAFDCFAACLFQ
CYDLLRPDIILELAWRHNIMDFAMPYLIQVTREYTSKVDKLEAADAERQKEGENSEHKSI
ILPEPQLMLTAGPGMGMPQYAPQYAGAYVAATQPNNMSPYPGYGGM
NT seq 5001 nt NT seq  +upstreamnt  +downstreamnt
atgctcaccaacataaatatcaacccgagctcgatctccttcacgaacttgacgatggaa
tcggacaagtttatctgcgttcgtgaaagggtcggagagacggctcaggttgtcatcatc
gacatgaacgatgcacaaaacccgatacgacgtccgattagtgccgattctgccatcatg
aatccggccagcaaggtgatcgccttgaaagctcaaaaaactctccaaatcttcaacatt
gagatgaagtccaagatgaaggcccacgcgatgacggaggaagtcgtattctggaaatgg
attacgctgaacacgttgtctttggtgacggaaacttcggtgtatcactggtctatggaa
ggagactcgactccggtcaaaatgttcgaccgtcattcgtcactgaacgggtgccagata
atcaactatagaaccgatcccaagcaggcttggcttcttttagttggaatttctgcgcaa
cagaaccgtgtaattggggcaatgcagctgtactcggtcgagcgtaaggtctcacaggct
attgagggccatgccgcttcatttgcaactttcaagatggaggagaacaaggaaacttcg
acactgttttgctttgctgtgcgctcggcgacaactgcaaaactgcacatcatcgaggtt
ggcgctcccccaactggcaatacggcttttaccaagaaagcggtggacgtgtttttccca
ccggaagcgggaagtgattttccggtcgctatgcaggtgtccccaaagtacgacgtgatt
tatctcatcaccaagtacggatacatccacatgtacgatatcgagacggctacttgcatc
tacatgaaccgtatttcggcggacacgattttcgtgacggcgccgcatgaatcgagcggt
ggcattattggggtcaatcgcaagggtcaggttctgtcggtgacggtcgacgaagagcag
atcattccctacattaacagcgtgctgcagaatccagatttagcgctgcgtatggccgtt
cgtaacaacttgtctggagctgaagatttgtttgtccgcaagttcaatcacatgttccag
aacggtcagtatgctgaagcagccaaggtcgctgcaatcgctccgaaaggaattttgcgt
acaccacagacgattcaaaagtttcagcaggttccagcacagccgggaaccaactcgccg
ccgctgttgcaatatttcggaattttgctcgaccagggtaaactgaacaagtacgagtcg
ttggagctctgccgtcctgttcttgctcagggtcgtaagcaactttgcgagaaatggctg
aaggaggaaaaactagagtgcagtgaggagctcggtgatttggtcaagccgtccgatcca
acaatggcactttcgatttatttgcgctccaacgttccaaacaaagtgatccaatgcttt
gctgaaactggccaattccagaagattgtcctttacgccaagaaggtcaactacaacccg
gactacatttttttgctgcgttctgtcatgcggactaacccggaacaaggtgccggattc
gcgagcatgttggttgccgacgaggagcctttggcggacatcaaccaaatcgttgacatt
ttcatggagcaaaacatggtccaacagtgtaccgcgttccttctggatgcccttaagaac
aatcgaccgagcgaaggatcgctgcaaactcgtctcttagagatgaacctgatgtctgcc
ccgcaggtcgccgatgctatccttgggaatgctatgtttacccattacgaccgcgctcac
atcgcccagctgtgcgagaaggcaggactgctccagcgtgctctggaacattacaccgat
ctgtacgacatcaagcgggcagttgtccacactcatttgctgaacggagactggttggtt
ggatttttcggcactctttccgttgaggattctctggaatgtctgaaggcaatgttgact
gccaacattcgtcaaaatttacaaatttgcgttcaaatcgctacaaagtatcacgaacag
ttaaccacgaaggcattgattgatctgtttgaaagcttcaagagctacgaaggattattt
tatttcctcggctcgattgtcaactttagccaggatccggaagttcacttcaagtacatt
caggcggcttgcaagacgaaccaaatcaaggaagttgagcgtatctgccgtgagtcaagc
tgctacaacgccgaacgggttaagaatttcctgaaagaggccaaacttaccgatcagttg
ccgctcattatcgtttgtgaccgtttcgatttcgtccatgaccttgtcctgtatctgtac
cgtaacagtctccaaaagtacattgaaatttacgttcaaaaggtgaacccatctcgtttg
cccgtcgtcgtcggtggtctcctggatgtggattgttccgaggatatcatcaagaacctg
attctggtcgtgaaaggacaattttcgactgatgaactggttgaggaggttgaaaagcgc
aaccgtctgaagctgctactgccgtggctcgaatctcgcgttcacgaaggttgcattgaa
ccggccacccataatgcgttggcgaagatctatatcgattcgaacaacaatcccgaacgt
ttcttgaaggaaaatcaattttacgatagccgcgtcgttggaagatactgcgagaaacgt
gatccacacctggcctgtgttgcgtacgaacgtggtcattgcgaccgtgagttgattgct
gtttgcaacgaaaactcgttgttcaaatcggaagctagatatctggttcgtcgccgcgat
ccggaactgtgggctgacgtgttgtccgaggccaatccctacaaacgtcagctgattgat
caggtcgtccaaacggctctctcggaaactcaagacccggacgatatctcagtaacggtg
aaggcattcatgactgcagatttaccgaacgagttgattgaactgctcgagaagattgta
ctggattcatccgtgttttctgatcaccgcaatctgcagaatttgcttatcctgactgca
atcaaggctgaccggagccgtgtcatggattacatcaaccgacttgacaactatgatgca
cctgatattgcaaacatcgccatcaacaacgagctgtatgaggaggcgttcgcaatcttc
aagaagtttgatgtcaacacttcagctattcaggttttgattgaacaggttcataacctt
gagcgagccaacgagtttgcggaacgttgtaacgaaccggcggtgtggtctcagctggcc
cgcgctcagctgcagcaaggattggtaaaggaagccatcgacagctacatcaaggcggat
gatcctagtgcttacattgatgtggttgaaaccgccagcaaaaatgaatcgtgggaggat
ttggtccgctatttgcaaatggcccgcaagaaggctcgcgaaagttacattgagagcgag
ctgatatatgcttacgctcgcactggcaggttggccgatctggaagagtttgtttcggga
ccgaaccacgcggacatccagaagatcggtgatcgctgcttcaacgataaaatgtacgaa
gctgccaagctgctgtacaacaacgtgagcaactttgcaaggttggccatcactttggtg
cacctgaaggaattccagggagcagtggacggggccagaaaggccaactcgacgcgcacc
tggaaggaagtttgcttcgcttgcgtcgatgccgaagagttccgtttggcacaaatgtgt
ggtctgcatatcgttgttcacgctgacgagctggaggatttgattacctactaccaggac
cgcggacactttgaggagctgattgggctgctagaagctgcgctgggactagaacgtgcc
cacatgggaatgttcactgagttggctattctgtactccaagtacaagccagccaaaatg
cgggaacatttggagctgttttggtcacgcgtcaacataccaaaggtcctgcgagcggcc
gaacaggcccacctctggtccgagttggtgttcctctatgacaagtacgaagaatacgat
aacgctgttctagcaatgatggcccatcctacggaagcttggcgtgaaggtcacttcaag
gacatcatcactaaagtggccaacattgagctgtactacagggcgatccagttctatctg
gactacaagccgcttctgctgaacgatatactcctagtgctggcaccccggatggaccac
acgcgtgccgtcaacttctttaccaagcagggacacttgcagttggtcaaaacatacctt
cgttctgtgcaaagtctgaataacaaggctattaacgaagccctcaacgggctgctcatt
gacgaagaggactaccagggactccgaacttcgatcgacgcattcgacaattttgacaac
atcgcccttgctcagaaattagagaaacacgagctaaccgaattcagaagaatcgccgct
tatctgtacaaaggtaacaaccgctggaagcagagcgtggaactgtgcaaaaaggatcgc
ctgttcaaggacgcgatggagtatgcggccgagtcgcaccagggcgagctggccgaagaa
ctgctcggatggttcctggaacgaggcgccttcgattgcttcgcagcatgcctattccag
tgctacgatctgctacgtcctgacattattctggaactggcctggcgccacaacatcatg
gactttgccatgccctacttgatacaggtgacgagagaatacacttccaaggtcgacaaa
ctggaggctgccgacgcggaacggcagaaagagggtgaaaattccgaacataaatcgatc
atcctgcccgaaccccaactcatgctgacagccggaccgggcatgggaatgccacagtac
gcgcctcaatatgccggagcgtacgtggcggcgacgcaaccgaataatatgtcaccatat
cctggatatggtggtatgtaa

DBGET integrated database retrieval system