KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ015005Help
Entry
CpipJ_CPIJ015005  CDS       T01079                                 

Definition
late histone H2B.L4
Orthology
K11252  
histone H2B
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 127 aa AA seqDB search
MAPPKSSGKAAKKSSGKASKNIVKGDKKAKKKTKRKESYAIYIYKVLKQVHPDTGISSKA
MSIMNSFVNDIFERIAAEASRLAQYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAV
TKYTSSK
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atggcaccaccgaaatctagtggaaaggcggccaagaagtccagcggcaaggcgtccaag
aacatcgtcaagggcgacaagaaggccaagaagaagaccaagcgtaaggagagctacgcc
atctacatctacaaggttctgaagcaggtccatccggacaccggaatctcgtcgaaggcg
atgagcatcatgaacagcttcgtgaacgatatcttcgagcggattgctgccgaggcgtcc
cgattggcgcagtacaacaagcggtccacgatcacgtcccgcgagatccagaccgccgtt
cgtctgctgctgcccggggagttggccaagcacgccgtgtccgagggcaccaaggcggtc
accaagtacactagctccaagtaa

DBGET integrated database retrieval system