KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ015005Help
Entry
CpipJ_CPIJ015005  CDS       T01079                                 

Definition
(RefSeq) late histone H2B.L4
  KO
K11252  histone H2B
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Brite
Chromosome and associated proteins [BR:cqu03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    CpipJ_CPIJ015005
Exosome [BR:cqu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CpipJ_CPIJ015005
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like DUF1931 TAF
Motif
Other DBs
NCBI-GeneID: 6048601
NCBI-ProteinID: XP_001865496
VectorBase: CPIJ015005
UniProt: B0X774
AA seq 127 aa AA seqDB search
MAPPKSSGKAAKKSSGKASKNIVKGDKKAKKKTKRKESYAIYIYKVLKQVHPDTGISSKA
MSIMNSFVNDIFERIAAEASRLAQYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAV
TKYTSSK
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atggcaccaccgaaatctagtggaaaggcggccaagaagtccagcggcaaggcgtccaag
aacatcgtcaagggcgacaagaaggccaagaagaagaccaagcgtaaggagagctacgcc
atctacatctacaaggttctgaagcaggtccatccggacaccggaatctcgtcgaaggcg
atgagcatcatgaacagcttcgtgaacgatatcttcgagcggattgctgccgaggcgtcc
cgattggcgcagtacaacaagcggtccacgatcacgtcccgcgagatccagaccgccgtt
cgtctgctgctgcccggggagttggccaagcacgccgtgtccgagggcaccaaggcggtc
accaagtacactagctccaagtaa

DBGET integrated database retrieval system