KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ015653Help
Entry
CpipJ_CPIJ015653  CDS       T01079                                 

Definition
cGMP-dependent protein kinase
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Brite
Enzymes [BR:cqu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     CpipJ_CPIJ015653
Protein kinases [BR:cqu01001]
 Serine/threonine protein kinases: AGC group
  PKG family
   CpipJ_CPIJ015653
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 790 aa AA seqDB search
METIKKENIQISDNGGPAAAAGSLTQSSTGATTTTTTSTSEVLRDEKSQIEKSVHSQSAL
KTKQSWFRKSNTCGSLYAKCACSNGVSGVGQASAGAGSPTGNHEGKVHRHSHGRPISTSE
KDFRKIRVLQAFVHPDTTTVFTQENRYPGSDSPTRASLITSAQAGEFQILHSTHSKRQST
PNCGVAGDYAAAFHPEFVLKKVAPKKQSSNGLPDSRSPSISIPSPRKVPLKKSSRSYPGL
SPSDSSVESIIRAFGQRSTSSSVDEVTEEEDCCAQTGSETEELGSLRDSYISFTAATEPE
KQPPPVNSDTNGSVDQVCESDIQLEERSDSDNSSSSSSNTSSDNSSQSPPSQLLNPLPPP
AIPGKLNPSAHEFFIQSGILGPMGNGSSVLLRKTSKIVPNVDAPVKEKIRKNSKMLYGSR
TVLTGGSGDSRRKSIPPDSNCDSFQSYGSTPTLNSSSGGGGGRHLPRTLEDEINNLRQLL
KARDEEISKLRREIDKLKSVLQQTTTNSMDVKKQQQQQSAPVVALQQLQKVPKTPPVVEG
DLLSSIQANYVMAGQQLPVSELFGVPGKGFKLNHGTPSNVGNGHIKPKGAMLVAMKKQGV
SGESCELMGSHSDIKIPKYDKDYSAKQLIKDAILENDFFKNIDSLQIREIVDSMYSREFR
AGEYVIHEGQAGSHLYVSASGNFEVLKDSKSLGFMGPGKAFGELAILYNCTRTASIRVLC
DSRVWVLDRRVFQQIMMRTGLQRIEENVNFLRSVPLLKNLSNDVLTKIADVLEVHFDVIT
IEASIKIDTK
NT seq 2373 nt NT seq  +upstreamnt  +downstreamnt
atggagacgattaagaaggaaaatatacaaataagtgataatggtggaccggccgcggct
gctggttcactcacacagtcgtcaacgggtgcgactacgactacgacgaccagcacttcg
gaggtgctgcgagacgaaaagtcccaaatcgagaaatcagttcactcgcaatcggcactc
aagacgaagcagtcgtggttccgcaagtccaacacttgtggcagcctgtacgccaagtgt
gcctgtagcaacggagtgtccggcgtaggacaggcttcagcgggagcagggtctccaacc
gggaaccacgagggcaaggttcatcgtcacagccacggccggccgatctcgacctcggag
aaggacttccggaagattcgggtgctgcaggcgttcgtccacccggacacgactacggta
tttacgcaggaaaatcgctatccgggaagtgactctccgacgagagcttcgttgattacg
tcggcacaagccggggagttccagattctgcactcgacacattccaagcggcagtctacg
ccgaactgtggcgtcgccggggactacgccgcggccttccatccggagtttgtgctgaag
aaggtagcgccgaagaagcagtcctctaacggacttccggacagcagatctccctcgata
agcattccatcgccgcgcaaggtaccgctgaagaagagctcgcgcagctatccgggactg
tctccgtcggacagcagtgtcgagtcgatcatccgggcgttcggacagcggtccacctcg
tccagtgtggacgaagttacggaagaggaggactgctgcgcccagaccggtagtgaaacg
gaagaacttggcagtttgcgggattcgtacatctcgttcaccgctgccaccgaaccggag
aagcaacctcccccggtgaacagtgataccaacgggtcggttgatcaagtgtgtgaaagt
gatattcagctagaagaacgaagtgacagtgataacagcagcagcagcagcagcaatacc
agcagtgacaacagttcccaaagtccaccctcccagctcctgaacccactcccacctcca
gcgatcccgggcaagcttaacccgtcggcgcacgagttcttcatccagtcgggcatcctc
ggaccaatgggcaatggatcgtcggtgctgctgcggaaaacgtccaagatcgtgccgaac
gtggacgcgccggtcaaggagaagatccgcaaaaattccaaaatgctgtacggtagccgg
acggtgctaaccggcggcagtggtgactcccgccgcaaatccattccgccggactccaac
tgtgatagcttccagtcgtacgggagcaccccgacgctcaacagcagcagcggcggtggt
ggtggccgccatctgccgcggaccctcgaagacgaaatcaacaacctgcggcagctgctc
aaagcccgggacgaggaaatcagcaaacttcggcgggagatcgacaaactcaagagcgta
ctccagcagacgaccaccaacagcatggacgttaagaagcagcagcagcagcaatcggcc
ccggtcgtggcactccagcagctccaaaaggtcccaaagaccccgccggtagtcgagggc
gatctgctgtccagcattcaggcgaactacgtgatggccggccagcagctgccggtttcc
gaactcttcggcgtgcccggcaagggcttcaagctgaaccacggaacgccgagcaacgtc
ggaaacggacacatcaaacccaaaggggccatgctggtggcgatgaagaagcagggagtt
tcgggcgagagttgcgaactgatgggcagtcactcggacattaagatccccaagtacgac
aaggactacagtgcgaagcagctgattaaggacgccattttggagaacgacttcttcaag
aacattgactcgttgcagattcgggagattgtggactcgatgtacagtcgggagtttcgg
gccggggagtacgtgattcacgagggacaggcagggtcgcacttgtacgtgtcggcttcg
gggaactttgaggtgttgaaggatagcaaatcgttggggttcatgggaccggggaaggcg
tttggagagctggcgattttgtacaactgcacgaggacggcttccattagagtgctgtgt
gactcccgcgtgtgggtcctggaccggcgcgtcttccagcagataatgatgcgcaccggg
ctgcagcggatcgaggagaacgtcaactttctgcggtcggtccccctgctcaagaacctc
agtaatgacgtacttaccaagattgcggacgtgctggaagtgcactttgacgtaattact
attgaagcttctatcaaaattgatacaaaataa

DBGET integrated database retrieval system