KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ015718Help
Entry
CpipJ_CPIJ015718  CDS       T01079                                 

Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cqu01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:cqu00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 356 aa AA seqDB search
MLLLSKSSLVKLLVQRVGQANLSTVAGLEKFKKINYEKIGIVGVPFEKGQRKKGVGLGPK
AIREAGLIDSIQEISNKLDIRDYGDIRYEALNLQGRLAANMKKLEHVASCTRFLSERVTQ
VLNEERLCLTLGGDHAIAIGSIDGHLKHCSDVAVIWVDAHADLNTNSTSPSGNIHGMPVA
LLAKELADYWPYIPGMDWQEPIISIKNMVYIGLRSVDPYERLIIEKFGIHAFGMREVEQY
GIHEVMRMALERVDPEGKKSLHVSYDIDSLDVLEAPSTGTSVRGGLTLREGIYIMEEAYN
TGRLAAVDLVEVNPSIGTPDDVRKTLDAAIHLLVAACGHNRRGNFADTLDIVGKKK
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgctgctgctgtcaaaaagttcgctggtgaagttgctggtgcaacgggtcggtcaagct
aacctgtcaacggttgcggggctggagaagttcaagaagataaactatgagaagatcggg
attgtgggggtgccgttcgagaagggtcagcgcaagaagggcgttgggttgggaccgaag
gcgatccgggaggcggggttgatcgacagtattcaggagatttcgaacaagttggacatc
cgggattatggggacatccggtatgaagcgttgaacctgcagggccggttggcggccaac
atgaaaaagctggagcacgtggccagttgtacgcggtttttgtcggagcgggtcacgcag
gtgttgaacgaggaacggttgtgtttgacgcttggaggtgatcatgcaattgcgattggg
tcgatcgatgggcacttgaagcattgcagtgatgtggcggtgatttgggtggatgcccac
gcggatttgaacacgaactcgacgtcgccttccggaaatattcacgggatgccggtggcg
ctgttggcgaaggagttggctgattactggccgtatattccggggatggactggcaggag
ccgatcatctcgatcaagaacatggtgtacattgggctgcgttcggttgatccgtacgaa
cggttgatcatcgagaagtttggcattcacgcgttcggcatgcgtgaggtggagcagtac
ggaattcacgaggtcatgaggatggcgctggagcgagttgatccggaagggaagaaaagt
cttcacgtgagctacgacatcgattcgctggatgtgctggaagctccaagtacggggacc
agtgtacgaggtggactcactctacgggaaggaatctacattatggaggaagcgtacaac
actggcaggttggcggcggtagacctcgtagaagtgaatccctcaattggaactccagac
gacgttcggaaaacgctggatgcggccattcaccttttagtggcagcttgtggacacaac
cgtagaggtaatttcgccgatacattggatatcgttggcaaaaagaagtga

DBGET integrated database retrieval system