KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ015718Help
Entry
CpipJ_CPIJ015718  CDS       T01079                                 

Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CpipJ_CPIJ015718
  Amino acid metabolism
   00330 Arginine and proline metabolism
    CpipJ_CPIJ015718
Enzymes [BR:cqu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     CpipJ_CPIJ015718
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 356 aa AA seqDB search
MLLLSKSSLVKLLVQRVGQANLSTVAGLEKFKKINYEKIGIVGVPFEKGQRKKGVGLGPK
AIREAGLIDSIQEISNKLDIRDYGDIRYEALNLQGRLAANMKKLEHVASCTRFLSERVTQ
VLNEERLCLTLGGDHAIAIGSIDGHLKHCSDVAVIWVDAHADLNTNSTSPSGNIHGMPVA
LLAKELADYWPYIPGMDWQEPIISIKNMVYIGLRSVDPYERLIIEKFGIHAFGMREVEQY
GIHEVMRMALERVDPEGKKSLHVSYDIDSLDVLEAPSTGTSVRGGLTLREGIYIMEEAYN
TGRLAAVDLVEVNPSIGTPDDVRKTLDAAIHLLVAACGHNRRGNFADTLDIVGKKK
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgctgctgctgtcaaaaagttcgctggtgaagttgctggtgcaacgggtcggtcaagct
aacctgtcaacggttgcggggctggagaagttcaagaagataaactatgagaagatcggg
attgtgggggtgccgttcgagaagggtcagcgcaagaagggcgttgggttgggaccgaag
gcgatccgggaggcggggttgatcgacagtattcaggagatttcgaacaagttggacatc
cgggattatggggacatccggtatgaagcgttgaacctgcagggccggttggcggccaac
atgaaaaagctggagcacgtggccagttgtacgcggtttttgtcggagcgggtcacgcag
gtgttgaacgaggaacggttgtgtttgacgcttggaggtgatcatgcaattgcgattggg
tcgatcgatgggcacttgaagcattgcagtgatgtggcggtgatttgggtggatgcccac
gcggatttgaacacgaactcgacgtcgccttccggaaatattcacgggatgccggtggcg
ctgttggcgaaggagttggctgattactggccgtatattccggggatggactggcaggag
ccgatcatctcgatcaagaacatggtgtacattgggctgcgttcggttgatccgtacgaa
cggttgatcatcgagaagtttggcattcacgcgttcggcatgcgtgaggtggagcagtac
ggaattcacgaggtcatgaggatggcgctggagcgagttgatccggaagggaagaaaagt
cttcacgtgagctacgacatcgattcgctggatgtgctggaagctccaagtacggggacc
agtgtacgaggtggactcactctacgggaaggaatctacattatggaggaagcgtacaac
actggcaggttggcggcggtagacctcgtagaagtgaatccctcaattggaactccagac
gacgttcggaaaacgctggatgcggccattcaccttttagtggcagcttgtggacacaac
cgtagaggtaatttcgccgatacattggatatcgttggcaaaaagaagtga

DBGET integrated database retrieval system