KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ015801Help
Entry
CpipJ_CPIJ015801  CDS       T01079                                 

Definition
mitogen activated protein kinase kinase 2
Orthology
K04368  
mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
MAPK signaling pathway - fly
FoxO signaling pathway
Dorso-ventral axis formation
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    CpipJ_CPIJ015801
   04068 FoxO signaling pathway
    CpipJ_CPIJ015801
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    CpipJ_CPIJ015801
Enzymes [BR:cqu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     CpipJ_CPIJ015801
Protein kinases [BR:cqu01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   CpipJ_CPIJ015801
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 405 aa AA seqDB search
MSKMTKNKLNLTLPPGSVDVTASQQTTPTPSFKTPSGTEYVIGKNNLLGKAKNSIDALTE
TLEELEIDENARKRIKVFLSQKEKIGELNDDDLDKLGELGSGNGGVVMKVRHIPTQLIMA
RKLIHLEVKPAIKKQIIRELKVLHDCNFPHIVGFYGAFYSDGEISICMEYMDGGSLDLIL
KRAGRIPEQILAKITCAVLKGLSYLRDKHAIMHRDVKPSNILVNSSGEIKICDFGVSGQL
IDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSLGLSLVEMAIGMYPIPPPDARTLDLIF
QERPEDNSPGQSSLIEPKSMAIFELLDYIVNEPPPKLEHNSFSDRFKDFVDRCLQKNPEE
RADLKTLINHDWIKNIEQEDVDIAGWVCKTMDLLPSTPKRNASPN
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagatgacgaaaaacaagcttaatctaacgctgccgccgggttcggtggacgtg
accgcaagccagcaaacgacgccgacgccctcgttcaaaacgccttccggcacggagtac
gtcatcgggaagaacaacctgctcgggaaggccaagaacagcatcgatgcgctgacggag
acgctggaggagctggagatcgacgagaacgcccgcaagcggataaaggtgtttttgagt
cagaaggagaagattggcgagctgaacgatgacgatctggacaagctcggcgagttgggc
tcggggaatggcggcgtggtcatgaaggtgcgccacattccgacgcagctgataatggcc
cgcaagttgatccacctggaggtgaagccggcgatcaagaagcaaatcatccgcgagctg
aaggtgctgcacgactgtaactttccgcacattgtcggcttttacggggcgttttacagc
gatggagagatcagcatctgcatggagtacatggacgggggctcgctggatttgatcctg
aagcgcgctggtcgcattccggagcagatcctggcgaagataacctgcgccgtgctgaag
ggactgagctatttgcgcgataagcacgccatcatgcaccgggacgtgaagccgagcaac
attctggtcaacagcagcggcgagattaagatttgtgatttcggcgtgtcgggccagctg
atcgattcgatggcgaactcgttcgtgggcacgcgcagctacatgtcgcccgaacgcctc
cagggcacccactactcggtccagtcggacatctggtccctcggtctgtccctcgtcgag
atggccatcggcatgtacccgatcccgccgccggacgcccgcaccctcgatctcatcttc
caggagcgccccgaggacaactcgcccggccagagcagcctgatcgagcccaagtcgatg
gcgatcttcgagctgctcgactacatcgtcaacgagccaccgcccaagctcgagcacaac
tcgttcagcgaccggttcaaggactttgtcgaccggtgcctccagaagaaccccgaagag
cgggccgacctcaagacgctaattaaccacgactggatcaaaaacattgaacaagaggac
gtggacattgccggctgggtgtgcaaaacgatggacctgctgccgtcgacgccgaagcgg
aacgcgtcgccgaactaa

DBGET integrated database retrieval system